KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0554Help
Entry
CKCE_0554         CDS       T02413                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
kci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kci01100  Metabolic pathways
kci01110  Biosynthesis of secondary metabolites
kci01130  Biosynthesis of antibiotics
kci01230  Biosynthesis of amino acids
Module
kci_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:kci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKCE_0554 (aroB)
Enzymes [BR:kci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     CKCE_0554 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFZ82977
LinkDB All DBs
Position
complement(585657..586733)
Genome map
AA seq 358 aa AA seqDB search
MKVVNVDVPSASYPINIGQGRLDHLDMAIPSDATSVVIVTNPKVAGLYLSRVKVSLQKTG
LPIFVIELPDGEIYKSWESLNKIFDILLINKIDRQSVLLALGGGVIGDITGFAASVYMRG
IRFIQVPTTLLAQVDSSVGGKTAINHPLGKNMIGSFYQPNSVEVDVDVLDTLDLREVSAG
LSEVIKYGLILDSNFWEWCENNIQDLLSLKKSSIEYAIKRSCELKAYVVGKDEKESGLRA
ILNLGHTFGHAIESGLGYGKWLHGEAVGCGLIQAIVLSSLVFDLDKTVLNRVKLLVSKIG
CPVIAPDFGFDKWIDLMLVDKKNTQGNIRFVLIDRIGHALIKQVSENEIRTTLEKTIK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgttaatgttgatgtacctagtgcttcttatcctattaatattggacaaggt
cgtttagatcacttagatatggctattccatcagatgccacgtctgtagttatagtaact
aatccaaaagttgcaggcctatatttgtctagagtgaaagtttctttgcaaaaaactggt
ttgccaatttttgtaattgagttgccagatggtgagatctataaaagttgggagagtttg
aacaaaatttttgatattcttctaattaataaaatagatcgtcaatctgttttgcttgca
ctaggaggtggggttattggggatataactggctttgctgcatcggtctatatgagaggc
attaggtttattcaggtcccgacaactttattggctcaagtagattcctccgttggaggg
aaaacagccataaatcatccattaggcaaaaatatgataggatcattttaccaacctaat
tctgtagaagttgatgtagatgttcttgatacccttgatcttagagaggtttcagcagga
ttatcagaggttataaagtatggattaatcttagattcaaatttttgggaatggtgtgaa
aataacatccaagatttgttatctttgaaaaagagctccatagagtatgctataaaacgt
tcttgtgagttaaaagcatatgttgttggtaaagatgaaaaagaatcaggtttacgtgct
attcttaatttaggacatacttttggtcatgctatagaatctggtttaggttatggtaaa
tggcttcatggtgaagctgtaggatgtggtttgattcaggcaatagtgttatcttcttta
gtatttgatttggataaaactgtgctaaaccgtgttaaattgttggtatctaaaatagga
tgtccagttattgcacctgattttggttttgataaatggattgatctcatgctggttgat
aaaaaaaatacacagggaaatattagattcgttttgatagatagaatagggcatgctttg
atcaaacaagtttctgagaatgaaataagaacaactttagaaaaaacaataaaataa

DBGET integrated database retrieval system