KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0736Help
Entry
CKCE_0736         CDS       T02413                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
kci00030  Pentose phosphate pathway
kci01100  Metabolic pathways
kci01110  Biosynthesis of secondary metabolites
kci01120  Microbial metabolism in diverse environments
kci01130  Biosynthesis of antibiotics
kci01200  Carbon metabolism
kci01230  Biosynthesis of amino acids
Module
kci_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CKCE_0736
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    CKCE_0736
Enzymes [BR:kci01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     CKCE_0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AFZ83144
LinkDB All DBs
Position
764693..766750
Genome map
AA seq 685 aa AA seqDB search
MNKDIYKSKIVLADAIRVLAMDAVQQANSGHPGAPMGMAEMAQAIWKDNLKHNPNDPGWI
NRDRFVLSNGHSSMLLYAVLHLTGYDVSMNDIRNFRQLHSKTPGHPEVGITPGIETTTGP
LGQGLANAVGMALAESLLAEEFNKPGFDIINHNTYAMVGDGCLMEGISHEVCSLAGTLKL
SKLIVLYDDNGISIDGNVKHWFNDDTAGRFRGYGWNVITDINGHDASAINAAIKLARSQS
KKPTIIICKTTIGKGSPNMAGTHNVHGSPLGKDEILASREFLGWPHDPFVIPQEMYDAWD
ARESGEKAQAIWKSKFDSYAIEYPSFAHELKRRMNGELPCNFDEFVQNFIKTTVKKAETL
ATRKASQLAIAEIANTLPEFLGGSADLTGSNYTDWKGVAPVRAANDKGISFGRHINYGVR
EFGMAAIMNGIALHGGYLPFGGTFLTFSDYSRNAIRMAALMKQRVIHVFTHDSIGLGEDG
PTHQSIEHVASLRLIPNLSVWRPCDTVETVVAWEYAIKRPVSVGMDVRDGGPTALLLSRQ
NLPFVERDSSTINSIEKGGYILKDVDNAQAIIIATGSEIAIALDAQNKLNELGIGVRIVS
MPSTDVFDKQDNSWKEKVLPGNLPKIAIEAGVTSGWYKYVGLDGLVLGIDRYGESAPAGE
LFKFFGLTSDNVVSSVKKILSLKGV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagacatatataaatctaaaattgttttggctgatgccattcgtgttctagca
atggatgcagtgcagcaagctaactctgggcatcctggtgctcctatgggtatggcagag
atggcacaggcaatatggaaagataatttaaaacataatccaaatgatccaggatggatt
aatagagatcgttttgttttgtcaaatggtcacagttctatgttgctttacgctgttttg
catttaactggctatgatgtttcaatgaacgatattaggaattttcgtcagttgcattct
aaaacccctgggcatcctgaagttggaattactccaggtatagaaacaacaacaggacct
cttggtcaggggttagctaatgctgttggtatggcattagcagaatctttattagcagaa
gagtttaataagccaggttttgatatcataaatcacaatacatatgcaatggtgggagat
ggttgccttatggaaggcatttctcatgaagtttgttctcttgctggcacgttaaaatta
tctaaactaatagttttatacgatgataatggtatttctatagatggaaatgtaaaacat
tggtttaatgacgatactgcaggacgattcagaggatatggttggaacgttattacagat
ataaatggtcatgatgcttctgctataaatgcagctataaagttagctcgctctcaatct
aaaaaaccaacaataattatttgcaaaactaccattggcaaaggttcgccaaatatggca
ggtactcataatgtgcatggatctcctttaggtaaggatgagatattagcatctagagaa
tttcttggatggcctcatgatccattcgtgattcctcaagaaatgtatgatgcttgggat
gctagggaatctggggagaaggcgcaagcaatatggaaatctaaatttgattcttatgca
attgaatatccaagttttgctcatgaacttaaacgtagaatgaacggtgagttaccatgt
aattttgatgagtttgttcaaaactttataaaaacaacagttaaaaaagcagaaacctta
gctacaagaaaagcttctcaacttgcaattgcagagatagctaatacattgcctgaattt
ttaggaggttctgctgatttgacaggttctaactatacagattggaaaggagttgctcct
gttagagctgctaatgataaagggatatcatttggaagacatattaattacggtgttcgt
gaattcggtatggctgcaattatgaatggtattgcattgcatggaggctacttgcctttt
ggcggaacatttttaactttctcagattattctcgtaatgcaattcgtatggctgcctta
atgaaacaaagggttatacatgtattcacgcatgattctataggattaggagaagatggt
cccactcatcagtctattgaacatgtggctagtttacgtctgattccaaatttatcagta
tggaggccttgtgatactgtagaaactgtagttgcttgggaatatgcaattaagaggcca
gtcagtgttggtatggatgttagagatggtggtcctacggcattattgctttccaggcaa
aaccttccttttgtcgaacgtgattcttctacaattaactctatagaaaagggcggttat
atcctaaaagatgttgacaatgcacaagcaataattattgctacaggttcagaaattgct
atagctttggatgcccaaaataaattaaatgaattaggtattggggttaggatagtttct
atgcctagcaccgatgtttttgataaacaagataatagttggaaagaaaaagttttgcca
ggcaatcttccaaagattgcaatagaagctggtgtaacttccggatggtataagtatgtt
ggcttagatggtttggttttaggtatagatcgttatggagaatcagctccagccggagag
ttatttaaattttttggattgacatcagataatgttgtttcgtcagtgaaaaagattttg
tcattgaaaggggtttag

DBGET integrated database retrieval system