Kosakonia cowanii: BWI95_03370 Help Entry BWI95_03370       CDS       T04691                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism kco  Kosakonia cowanii Pathway kco02024   Quorum sensing kco03018   RNA degradation Brite KEGG Orthology (KO) [BR:kco00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BWI95_03370  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BWI95_03370  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:kco03019]     BWI95_03370    03036 Chromosome and associated proteins [BR:kco03036]     BWI95_03370 Messenger RNA biogenesis [BR:kco03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BWI95_03370 Chromosome and associated proteins [BR:kco03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BWI95_03370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  APZ04173 UniProt:  A0A807LD11 LinkDB All DBs Position complement(723729..724034) Genome browser AA seq 101 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGSNNNYHHGSNAQGSAQQDSEETE NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcctgaacgcactgcgtcgggaacgtgtt ccagtttcaatttatttggtgaatggtatcaaactgcaaggacagattgagtctttcgat cagttcgttattttgctgaaaaacacagtcagccaaatggtttataagcacgcgatttcg accgttgttccgtcccgcccggtttcacatcacagcaacaatgcgggtggcggctccaac aacaactaccaccatggtagcaacgcgcaaggctctgcacagcaggacagcgaagaaacc gagtaa

DBGET integrated database retrieval system