KEGG   Kosakonia cowanii: BWI95_06880Help
Entry
BWI95_06880       CDS       T04691                                 

Definition
(GenBank) double-stranded uracil-DNA glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
kco  Kosakonia cowanii
Pathway
kco03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:kco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BWI95_06880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kco03400]
    BWI95_06880
Enzymes [BR:kco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     BWI95_06880
DNA repair and recombination proteins [BR:kco03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BWI95_06880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: APZ04803
LinkDB All DBs
Position
complement(1493801..1494307)
Genome map
AA seq 168 aa AA seqDB search
MIHDILAPGLRVVFCGINPGKSSAHTGFHFAHPGNRFWKVIHQAGFTDQQLRPEDEHHLL
DTRCGITMLVQRPTVQATEVGLHELRTGGRDLVHKIEEYQPAALAVLGKQAFEQAFSVRG
AKWGKQEMTIGVTQIWVLPNPSGLNRASLEKLVEAYRELDDALASRGL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgatattctggcgccggggctgcgcgtcgtgttttgtggcattaatccgggg
aagtcctctgcccatacggggtttcattttgcgcatccggggaatcgcttctggaaagtg
attcatcaggccggctttaccgaccagcagttgcgccctgaggatgagcaccatctgctg
gatacgcgctgcggcattaccatgctggtgcagcgtccgacggtgcaggcgacggaagtc
gggctacatgagctgcgtaccggcggcagggatctggtacataaaatagaggagtatcag
cccgccgcgctggcggtgcttggcaaacaggcgtttgagcaggcctttagcgtgcgcggt
gcgaagtggggtaagcaggagatgaccattggcgtgacgcaaatctgggtgctgcccaat
cccagcggcctgaaccgcgcgtcgttagagaaactggttgaagcctatcgcgagcttgat
gacgcgctggcatcgcgcggcttgtaa

DBGET integrated database retrieval system