KEGG   Kosakonia cowanii: BWI95_07310Help
Entry
BWI95_07310       CDS       T04691                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
kco  Kosakonia cowanii
Pathway
kco00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:kco00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BWI95_07310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kco01002]
    BWI95_07310
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kco01011]
    BWI95_07310
Enzymes [BR:kco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BWI95_07310
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BWI95_07310
Peptidases and inhibitors [BR:kco01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   BWI95_07310
Peptidoglycan biosynthesis and degradation proteins [BR:kco01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BWI95_07310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 TrbL
Motif
Other DBs
NCBI-ProteinID: APZ04882
LinkDB All DBs
Position
1585556..1586989
Genome map
AA seq 477 aa AA seqDB search
MRFPSFIIGLSTSIALNVQAANVDEYINQLPDGANLALMVQKVGAEAPEIDYHAKQMALP
ASTQKVITALAALLQLGPDFRFTTTLESKGSVDGGTLKGDLVARFGGDPTLKRQDIRNMV
ATLKKSGVQKIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIIDRNCFSISLYS
AQNAGDLAYIRVASYYPVNMFSQVRTLARGSAEAQYCELDVVPGDLNRFTLTGCLPQRAD
PLPLAFAVQDGASYAGAILKQELTQAGITYTGTLLRQTQVNQPGTVIASKQSAPLHDLLK
IMLKKSDNMIADTVFRMIGHARFGVPGTWRAGSDAVRQILRQQAGVDLGNTIIADGSGLS
RHNLLAPATMMQVLQYIAQHDTELNFISMLPLAGYDGSLQYRAGLHEAGVDGKVSAKTGS
LQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttcccagctttatcatcggattgtccaccagtatagccctgaatgttcaggcc
gcgaatgtcgacgagtacatcaaccagcttccggatggtgccaacctggcgttgatggta
cagaaggtcggcgccgaggctcccgaaattgattatcacgccaaacagatggcgttgccg
gcgagcacccagaaagtgatcaccgcgctggctgcactcctacaactggggccggacttt
cgctttacaaccacgctggaaagcaaaggttctgtcgacggcggtacgctaaaaggcgac
ttagttgcacgatttggtggcgatccgacgctaaaacgtcaggatattcgcaatatggtc
gcaacgcttaaaaaatcaggcgtgcaaaaaatcgatggcaacgtgctgatcgatacctcg
atcttcgccagtcatgacaaagcgccgggctggccgtggaacgatatgacgcagtgcttt
agtgcgccgcccgccgctgccatcatcgatcgcaactgtttttccatttcgctgtatagc
gcgcaaaacgcgggtgatttggcctacatccgggtcgcctcttactatccggtgaacatg
ttcagccaggtacgcaccctggcgcgcggatcggccgaagcacaatattgcgaactggat
gtggtgccgggcgatctcaaccggttcacgttaacaggctgtttgcctcagcgcgccgat
ccgttgccgctcgccttcgccgtgcaggatggtgccagctatgcaggggctattctcaag
caggagctaacgcaggcgggcattacctataccggcacgctgctgcgccagacgcaggtc
aatcagcccggtaccgttatcgccagtaaacaatccgcgccgttacacgatctgctgaag
atcatgctgaagaagtccgacaacatgattgcggataccgtctttcgcatgattggccat
gcgcgctttggcgtgccgggcacctggcgagcgggttcggacgcagtcaggcagatcctg
cgccagcaggccggggtcgatctgggcaacactattattgcggatggttccggcctctcg
cgccataacctgctcgcaccggcgaccatgatgcaggtgctgcaatatattgcccagcat
gataccgagcttaactttatctcgatgttgccgctggcaggctatgacggctcgctgcaa
taccgcgcagggctgcatgaagcgggcgtcgacggtaaggtatcagccaaaacaggctcg
ctgcagggtgtttataacctggcagggtttatcaccaccgccagcggtcagcgaatggca
tttgtgcagtatctttcggggtatgcggttgaacccgccgatcagcgcaatcgccgtatt
ccgctggtgcgtttcgaaagccgcctctacaaagatatctatcagaacaactaa

DBGET integrated database retrieval system