KEGG   Kosakonia cowanii: BWI95_09275Help
Entry
BWI95_09275       CDS       T04691                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kco  Kosakonia cowanii
Pathway
kco00250  Alanine, aspartate and glutamate metabolism
kco00410  beta-Alanine metabolism
kco00640  Propanoate metabolism
kco00650  Butanoate metabolism
kco01100  Metabolic pathways
kco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BWI95_09275
   00650 Butanoate metabolism
    BWI95_09275
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BWI95_09275
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BWI95_09275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kco01007]
    BWI95_09275
Enzymes [BR:kco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BWI95_09275
Amino acid related enzymes [BR:kco01007]
 Aminotransferase (transaminase)
  Class III
   BWI95_09275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: APZ05230
UniProt: A0A1U7E1B3
LinkDB All DBs
Position
2004886..2006148
Genome map
AA seq 420 aa AA seqDB search
MKNSELHQRRVAATPRGVGVMCGFYAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VMAAVEKQLQAFTHTAYQIVPYESYITLAERINARVPIDGPAKTAFFSTGAEAVENAVKI
ARAYTKRPGIIAFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAHYPNELHGVSTE
QALQSLTHLFKADIAPDQVAGILLEPVQGEGGFNIAPPEFMQALRALCDSHGILLIIDEV
QSGFARTGKLFASEHYAIKPDLITMAKSLAGGLPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEKLCERANQLGKDLVEVLTHAKAHCTHIADIRAQGSMVAVEFQD
PQTGAPSPEFTKQVQDKALQAGLLLLSCGVYGNVIRFLYPLTIPDEQFRKALDIIQRSLM
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatagtgaattacatcagcggcgtgtagccgccacgccgcgcggggttggcgtg
atgtgtggcttctacgctgagaaagcagaaaacgccacgctatgggatgtggaaggcaac
gaggtgattgatttcgccgccgggattgcggtgctaaacaccggccatcgacacccaaaa
gtgatggccgcagtcgaaaaacagctccaggcctttacgcacaccgcgtaccaaatcgtt
ccttacgaaagctatatcacacttgccgagcgcatcaacgcgcgcgtccccattgatggc
ccggcgaaaaccgctttcttctctaccggcgccgaagcggttgaaaacgcggtaaaaatc
gcccgcgcttataccaaacgtccgggcattatcgcctttggcggcggctttcacggtcgt
acctttatgaccatggcgctgacgggaaaagttgcaccttataagatcggcttcgggccg
tttcccggttcggtttatcacgcccactatccaaatgaattgcacggcgtcagcactgaa
caggcgctgcaaagcctgacgcatctcttcaaagccgatatcgcgcccgatcaggtcgcc
gggatcctgttagagccggtgcagggtgaagggggctttaatattgctccgccagagttt
atgcaggcgctgcgcgccctgtgcgacagccacggcattctgctgatcatcgacgaggtg
cagagcggttttgcccgcaccggcaaactcttcgctagcgagcattacgccatcaaaccc
gatctcatcactatggcgaaaagcctggcgggcggtttaccgctctcggcagttgccgga
cgtgccgaagtgatggatgctcctgcgcctggcggcctgggcggaacctatgccggtaac
ccgctggcggtggcggcagcgcatgcggtgctggatgtgattgaagaggagaagctgtgc
gaacgcgccaaccagttgggcaaagatctggtcgaagtgctgacccatgcgaaagcgcat
tgcacgcatattgccgatatccgcgcgcagggctcgatggtggcggtcgagtttcaggac
ccgcaaaccggcgcgccgtccccggagttcaccaaacaggtgcaggataaagcgcttcag
gccgggctgctgctgctaagctgcggcgtctatggcaacgttatccgcttcctctatccg
ctgaccattcctgatgagcagttccgaaaagcgctggatattatccagcggtcgttaatg
tag

DBGET integrated database retrieval system