KEGG   Kosakonia cowanii: BWI95_10675Help
Entry
BWI95_10675       CDS       T04691                                 

Definition
(GenBank) D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
kco  Kosakonia cowanii
Brite
KEGG Orthology (KO) [BR:kco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kco01002]
    BWI95_10675
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kco01011]
    BWI95_10675
Enzymes [BR:kco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BWI95_10675
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BWI95_10675
Peptidases and inhibitors [BR:kco01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   BWI95_10675
Peptidoglycan biosynthesis and degradation proteins [BR:kco01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BWI95_10675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: APZ05473
LinkDB All DBs
Position
complement(2272090..2273247)
Genome map
AA seq 385 aa AA seqDB search
MKRCLLLCAMWCALGLTSVRAAQQSPDPVFASEIVDRYANHIFYGSGATGMAMVVIDGNQ
RVFRSFGETRPGNNVRPQLDSVVRIASLSKLMTSEMLVKLLDQGRVRLDDPLSKYAPPGA
RVPTYQGAPITLVNLATHTSALPREQPGGAAVRPVFVWPTREQRWNWLATAKLKTAPGTQ
AAYSNLAFDLLADALARAAGKPYPQLFEEQITRPLGMKDTTFTPSPDQCKRLMVAEKGAS
PCNNTLAAIGSGGVYSTPGDMMRWMQQFLSSDFYHRDTQADRMQTLIYPRERLTKVVGMD
VPGKADALGLGWVYMAPKEGHPGIIQKTGGGGGFITYMAMVPQHNVGVFVVITRSPLTKF
TNMSDGMNDLVSELSNNKPVAIPAS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgttgtctgcttctctgtgcgatgtggtgtgcgctgggcctgaccagcgtccgg
gcggcgcagcaatcccccgacccggtgtttgcttctgaaattgtcgatcgttatgccaac
catatcttctatggcagcggcgcaaccggcatggcaatggtggtgattgacggcaaccag
cgcgtctttcgcagtttcggcgaaacccgtcccggcaacaatgtgcgcccgcagctcgac
tcggtggtgcgcatcgcctcgctctccaagctgatgaccagtgagatgctggtgaagctg
ctcgatcagggccgcgtgcgccttgacgatccgttaagtaaatatgccccgcctggcgcg
cgcgtaccgacttaccagggcgcgccgatcacgctggttaacctggcgacgcacaccagc
gccctgccgcgtgaacagcccggcggcgcagcggtgcgtccggtgtttgtctggccgacg
cgcgagcagcgctggaactggcttgccaccgccaaactgaaaaccgcgccgggcacccag
gcggcgtattccaacctggcctttgatctgctggcagatgcgctggcgcgcgcggcggga
aaaccctatccgcagctgtttgaagagcagatcacccgcccgctgggcatgaaagacacc
acctttaccccgtcgccggatcagtgcaaacggctgatggtggcggaaaaaggcgccagc
ccgtgcaacaacacgctggcggcgattggcagcggcggcgtctactccacgcccggcgat
atgatgcgctggatgcagcagttcctctcctccgacttttaccaccgcgatacgcaggcc
gaccggatgcagacgctgatctacccgcgcgaacgcctgacgaaagtggtgggaatggat
gtaccgggtaaagccgacgccctcggtctcggctgggtctatatggccccgaaagagggt
cacccggggattattcagaagaccggcggcggcggtgggtttatcacctatatggcgatg
gtgccgcagcataacgttggcgtgttcgtggttatcacccgttcaccgttgaccaaattt
accaatatgagcgacggcatgaacgatctggtgagtgagctgagcaacaataaaccggtg
gcgatccccgcctcctga

DBGET integrated database retrieval system