KEGG   Kosakonia cowanii: BWI95_10705Help
Entry
BWI95_10705       CDS       T04691                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kco  Kosakonia cowanii
Pathway
kco00473  D-Alanine metabolism
kco00550  Peptidoglycan biosynthesis
kco01100  Metabolic pathways
kco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BWI95_10705
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BWI95_10705
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BWI95_10705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kco01011]
    BWI95_10705
Enzymes [BR:kco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BWI95_10705
Peptidoglycan biosynthesis and degradation proteins [BR:kco01011]
 Precursor biosynthesis
  Amino acid ligase
   BWI95_10705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 NHase_alpha RimK ssDNA_TraI_N
Motif
Other DBs
NCBI-ProteinID: APZ07632
LinkDB All DBs
Position
complement(2277233..2278333)
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGVVFGGKSAEHEVSLQSAKNIVDAMDTSRFEVVLLGIDKSGQWHISDAQNYLQN
ASDPARIALNPSDNSVALVPGVAEQQLIAADNRSPLPNVDVIFPIVHGTLGEDGSLQGML
RLANLPFVGSDVLASAACMDKDITKRLLRDAGLAIAPFITLTRANRDSFSFSDVTAQLGL
PLFVKPANQGSSVGVSKVTNEAQYVDALRLAFAFDKKVVVEKGIVGREIECAVLGNDEPQ
ASTCGEIVLNSEFYAYDTKYIDDQGAQVVVPAAIDPETNEKIRAIAIEAYKTLGCEGMAR
VDVFLTPDNDVVINEINTLPGFTNISMYPKLWQASGISYSALITRLIELALERHQQSSAL
KISMND
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgcgggtaggggtcgtcttcggcggcaaatcggcggagcatgaagtgtcg
ttacagtcggcgaagaacattgtcgatgcgatggatacatcgcgctttgaagtggtgctg
ctgggtattgataaatcagggcagtggcatattagcgatgcgcagaactatctgcaaaac
gccagcgatccggcgcgtatcgcgctgaatccgtcggacaacagcgtggcgctggtgccg
ggcgtcgccgaacaacaactgattgcggcggataaccgctcgccgctgccgaatgttgat
gttattttcccgatcgttcacggcacgctcggcgaagatggctccctgcaggggatgctg
cgcctcgccaacctgccgtttgttggctccgatgtgctcgcgtccgcagcctgcatggat
aaagacatcaccaagcgcctgctgcgcgacgccggtctggccatcgcgccgtttatcacc
ctgacgcgcgccaaccgcgacagcttcagctttagcgacgtgaccgcgcaactcggcctg
ccgctgtttgttaaacccgccaaccagggctcatccgtcggcgtcagcaaagtaaccaac
gaagcgcagtatgttgacgcgctgcgtctggcctttgctttcgacaaaaaagtggtagta
gagaaagggatcgtcgggcgcgagatcgagtgcgcggtgctgggcaatgatgagccgcag
gccagcacctgcggtgaaattgtgctgaacagcgagttctacgcttacgacaccaaatac
attgacgatcagggcgcgcaggttgtggtgccggccgccatcgatcccgagaccaacgag
aagatccgcgcgatcgccattgaagcgtataaaacgctgggctgcgaagggatggcgcgg
gtggatgtgttcctgacgccggacaacgacgtggtgatcaatgagatcaacaccctgccc
ggcttcaccaatatcagcatgtacccgaaactgtggcaggcgagcggcatcagctatagc
gcgctgatcacccgcctgattgagctggcgctggagcgccaccagcaaagcagcgcgctg
aagatctccatgaacgattaa

DBGET integrated database retrieval system