KEGG   Kosakonia cowanii: BWI95_10725Help
Entry
BWI95_10725       CDS       T04691                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kco  Kosakonia cowanii
Pathway
kco00730  Thiamine metabolism
kco00790  Folate biosynthesis
kco01100  Metabolic pathways
kco02020  Two-component system
Module
kco_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BWI95_10725
   00790 Folate biosynthesis
    BWI95_10725
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BWI95_10725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kco04147]
    BWI95_10725
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kco00537]
    BWI95_10725
Enzymes [BR:kco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BWI95_10725
Exosome [BR:kco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BWI95_10725
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kco00537]
 Enzymes
  BWI95_10725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: APZ05482
UniProt: A0A1U7E1Y9
LinkDB All DBs
Position
2281042..2282457
Genome map
AA seq 471 aa AA seqDB search
MKQSALYLALLSLLASPAIYAESSVAPVLESRAAHGDISAPGGARRLTGDQTAALRDSLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKSGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHDNDHMTILEMAKAAGLATGDVSTAELQDATPAA
LVSHVISRRCYGPTVTSEKCALNALEKGGKGSITEQLLNARPDVTLGGGAKTFSETATAG
EWQGKTLREQAQARGYQLVNDAASLAAISTANQDKPLLGLFADGNMPVRWEGPKASLHGN
LDKPAVTCTPNPKRTDSVPTLAAMTEKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADTKAPGLSQALTTKDGAVM
AMTYGNSEEESMEHTGTQVRIAAYGPHAANVVGLTDQTDLFYTMKAALSLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacagagcgcgttatatcttgcactattatccctgcttgcctcgcctgctatttat
gcagaatcatctgtagcgccggttcttgaaagccgcgcagctcacggcgatatttccgcg
cccggtggcgcacgccgtttgacgggcgaccagactgccgccctgcgtgattccctgaat
gacaagccagccaaaaatattattctgctgattggcgacggcatgggcgattccgaaatt
accgccgcgcgaaattatgccgaaggggcgggcggtttctttaaaggtattgatgcgctg
ccgctgaccggccagtacacccactactcgctggacaaaaaaagcggtaaacctgattac
gtcaccgactctgccgcctcggcgacagcgtggagcaccggcgtaaaaacctataacggt
gcgctcggcgtcgatatccacgacaacgatcatatgaccatccttgagatggcaaaagcc
gccggtctggcgacgggcgacgtctccactgctgaattgcaggacgcgacgcctgccgca
ctggtctcccatgttatctctcgccgctgctacggcccgacggtgaccagcgagaagtgc
gcgcttaacgcgctggagaagggcggcaaaggctcgattaccgaacaactgctgaacgcg
cgcccggacgtgacgctcggcggcggggcaaaaaccttcagtgaaaccgccaccgccggt
gagtggcagggcaaaaccctacgcgagcaggcgcaggcgcgcggttaccagctggtgaac
gatgccgcatcgcttgcagcaatcagtacagccaatcaagataaaccgctgctcggcctg
tttgccgacggtaatatgccggtgcgctgggagggaccgaaagcctctctgcatggcaac
ctggataaacctgccgtgacctgtacgccaaacccgaaacgcaccgacagcgtgccgacg
ctggcggcgatgacggaaaaagcgattgaactgctgagcaaaaatgagaagggcttcttc
ctgcaagtggaaggggcttcgattgataaacaggatcacgcggcgaacccgtgcggccag
attggtgaaactgttgatctcgacgaagcggtacagaaagcgctggagtttgcgcgtaaa
gatggcaatacgctggtgatcgtcaccgcagaccacgcccatgccagccagatcatcccg
gcagataccaaagcaccaggcctgagccaggcgctgaccaccaaagatggcgcggtaatg
gcgatgacctacggcaactcggaagaggagtcgatggagcataccggcacgcaggtgcgc
attgcggcgtacggcccgcatgcagcgaacgtggtggggctgacggatcagaccgatctc
ttctacaccatgaaagcggcgctgagcctcaagtaa

DBGET integrated database retrieval system