KEGG   Kosakonia cowanii: BWI95_10740Help
Entry
BWI95_10740       CDS       T04691                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
kco  Kosakonia cowanii
Pathway
kco00330  Arginine and proline metabolism
kco01100  Metabolic pathways
kco01110  Biosynthesis of secondary metabolites
kco01130  Biosynthesis of antibiotics
kco01230  Biosynthesis of amino acids
Module
kco_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:kco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BWI95_10740
Enzymes [BR:kco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     BWI95_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Sacchrp_dh_NADP Shikimate_DH OCD_Mu_crystall NAD_Gly3P_dh_N 3HCDH_N IlvN PDH 2-Hacid_dh_C ApbA GFO_IDH_MocA FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: APZ05485
LinkDB All DBs
Position
complement(2284608..2285414)
Genome map
AA seq 268 aa AA seqDB search
MEKKIGFIGCGNMGKAILGGLIASGEVKPGQIWVYTPTPDKVAALQQEYGINAAQSAQEV
AQIADIVFGAVKPNIMVKVLSDIASSLNKETLVVSIAAGVTLDQLARALGHDRKIIRVMP
NTPALVNAGMTSITPNALVTSEDTADVLTIFRCFGEAEVIAEGMIHPVVGVSGSAPAYVF
MFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGKHPAELKDMVCSPGGTTIEAV
KVLEDKGFRAAVMDAMAACMAKSEKLSA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaatcggttttatcggctgcggtaacatgggtaaggcgattctcggcggg
ctgatcgccagcggcgaggtgaaaccggggcagatttgggtttacacgccaacgcctgat
aaggtcgccgccctgcaacaggagtatggcattaacgccgcgcaaagcgcgcaggaagtg
gcgcagatcgccgatattgtctttggcgccgtgaagccgaacatcatggtgaaagtgctt
agcgatatcgcctccagcctgaacaaagagacgctggtggtctccatcgcggcgggcgta
acgctcgatcagctggcgcgcgcgctgggccacgaccgcaaaattatccgcgtgatgccg
aacacccccgcgctggttaacgccgggatgacctccatcacgccaaatgcgctggtgacg
tctgaagataccgccgatgtgctgaccattttccgctgctttggcgaagcggaagtgatt
gccgaagggatgatccacccggtagtcggcgtcagcggctcggctccggcgtatgtgttt
atgtttatcgaagcgatggccgatgccgccgtgctgggcggtatgccgcgcgcgcaggcc
tataaatttgctgcgcaggcagtaatgggttcggcgaagatggtgctggaaacgggtaaa
caccctgccgaactgaaagatatggtctgctcgccgggcggcaccaccatcgaagcggtg
aaggtgctggaagataagggttttcgcgctgcggtgatggacgcgatggccgcctgtatg
gcgaagtcggaaaaactgagcgcgtaa

DBGET integrated database retrieval system