KEGG   Kosakonia cowanii: BWI95_11975Help
Entry
BWI95_11975       CDS       T04691                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kco  Kosakonia cowanii
Brite
KEGG Orthology (KO) [BR:kco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BWI95_11975
Enzymes [BR:kco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BWI95_11975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 FAD_oxidored Thi4 K_oxygenase Glutaredoxin NAD_binding_8 FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: APZ05710
LinkDB All DBs
Position
2550458..2552020
Genome map
AA seq 520 aa AA seqDB search
MLDTTMKTQLKAYLEKLTKPVELIATLDDSAKSNEIKELLGEIAELSDKVTFKEDNTLAV
RKPSFLITNPGSHTGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVYVNGQE
FGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAASVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQQFAGALKAHVADYDVDVIDSQSASKLVPASVEG
GLHQIETASGAVLKARTVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIVLNAQTTEVKGD
GTKVTGLEYRDRVSGDVHQVALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactacaatgaaaacccagctcaaggcttatcttgagaaactgaccaagcct
gttgagttgatcgcgacgctggatgacagcgcaaaatctaatgagatcaaagagctgctg
ggcgaaatcgccgagctctctgacaaagtgacctttaaagaggacaacaccctggcggtg
cgtaagccctctttcctgatcaccaacccaggctcgcacactggcccgcgctttgctggc
tctccgctggggcatgaatttacttcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaagcgcaggcgctgctggagcagatccgcgatatcgacggcgacttcgag
ttcgagacttactactcgctctcctgccacaactgcccggacgtggtacaggcgctgaac
ctgatgtcggtgctgaacccgcgcatcaagcacacggcgattgacggcggcaccttccag
aacgaaatcaccgatcgcaacgtgatgggcgttccggcggtctacgttaacggtcaggag
tttggtcagggtcgtatgacgctgacagagatcgtggcgaaaattgataccggcgcggaa
aaacgtgcggcggaagagctgaacaaacgtgacgcttacgatgtgctgattgtcggctcc
ggcccggcgggcgcagcggcctctgtttattctgcccgtaaaggcattcgtaccggtctg
atgggcgaacgcttcggcggccaggtgctggataccgttgatatcgaaaactacatctcc
gtgccgaaaaccgaaggccagcagttcgcgggcgcactgaaagcgcacgttgcggattat
gatgttgacgtgatcgacagccagagcgccagcaagctggttccggcgtcggttgaaggc
ggcctgcatcagattgaaaccgcgtctggcgcggtgctgaaagcgcgtaccgtgatcatt
gcgaccggtgcgaagtggcgcaacatgaatgtgccgggcgaagatcagtatcgcaccaag
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaagcgcgtggcggtg
atcggcggcggtaactccggcgtggaagcggctatcgatctggccgggattgttgaacat
gtgacgctgctggagtttgctccggagatgaaagcggatcaggtgttgcaggataaagtt
cgcagcctgaagaacgttgatatcgtgctgaatgcgcagaccaccgaagtaaaaggcgac
ggcaccaaagtgaccggccttgagtaccgtgaccgcgtgagcggcgatgtgcatcaggtt
gcgctggcggggatcttcgttcagatcggtctgctgccgaacaccacctggctggaaggc
gcgattgagcgcaaccgcatgggcgaaatcatcatcgacgccaaatgcgaaaccagcgtg
aaaggcgtgttcgcggcgggtgactgcaccacggtgccgtacaaacagatcattatcgct
accggcgaaggtgccaaagcgtcgctgagcgcgtttgattacctgatccgtaccaaagcg
taa

DBGET integrated database retrieval system