KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0812Help
Entry
Kcr_0812          CDS       T00668                                 

Definition
(GenBank) lysine biosynthesis enzyme LysX
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00300  Lysine biosynthesis
kcr01100  Metabolic pathways
kcr01210  2-Oxocarboxylic acid metabolism
kcr01230  Biosynthesis of amino acids
Module
kcr_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:kcr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Kcr_0812
Enzymes [BR:kcr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     Kcr_0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 ATPgrasp_ST CPSase_L_D2 ATP-grasp_5 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACB07559
UniProt: B1L530
LinkDB All DBs
Position
820999..821838
Genome map
AA seq 279 aa AA seqDB search
MRVALVYERLREEESQILRAMERLGVEGVLLHLPSNHYRLEARASEADVALIRTMSHTNS
VASSEILSNRGLKCVNSPEVIRVCGDKLLTSLKLISSGIPTPKTAVAFSPEGALRAAKEI
GFPVVVKPVNGSWGRLVSLARDEEELRSIIEHREAIGSPYYRIHYIQEYIEKPDRDIRAY
GTDKEFITAIYRISNHWITNTARGARVEPVRATEDLRDLVLRTCEALGGGFLGIDIVEDR
ERGLMVLEANAVTEFKNAARATGVDIAGELVRYAVSRCS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagggtagctctggtctacgagaggctgagggaggaggagtcccagatactgagggcc
atggagaggctaggtgttgagggagtcttgcttcatctaccatcgaatcactacagattg
gaagctagagcctcggaagctgatgtagccctcatcaggacgatgagtcacactaattca
gtcgcctcctcggaaattttatcgaatcgtgggctgaaatgtgttaactcccctgaggtc
ataagggtatgcggcgataagctcctaacctccctcaagttgattagctctggcatacct
acccctaagacagctgtagccttctccccggagggagctttgagggcagccaaggagatt
ggcttccccgtcgtagttaagcccgtcaacgggagctggggtaggttagtctcgctggct
agggatgaggaggaactgaggagcataattgagcatagggaggcgataggttccccttac
tataggatacactacattcaggagtacatcgagaagccggatcgtgatataagggcttat
gggactgataaagaatttataacagctatatataggatatcaaatcactggataactaat
acggctagaggagctagagttgagcccgtgagagctactgaagatctcagagatctagtc
ttgaggacatgtgaagctctgggcgggggtttcttgggcatagatatagttgaggatagg
gagaggggtcttatggtcctagaagcaaatgcagtgactgagttcaagaacgcggcgagg
gctactggagttgacatcgctggggagctagttaggtacgcggtgtctagatgttcatga

DBGET integrated database retrieval system