KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1307Help
Entry
Kcr_1307          CDS       T00668                                 

Definition
(GenBank) Orotidine 5'-phosphate decarboxylase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00030  Pentose phosphate pathway
kcr00680  Methane metabolism
kcr01100  Metabolic pathways
kcr01120  Microbial metabolism in diverse environments
kcr01200  Carbon metabolism
kcr01230  Biosynthesis of amino acids
Module
kcr_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Kcr_1307
  09102 Energy metabolism
   00680 Methane metabolism
    Kcr_1307
Enzymes [BR:kcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     Kcr_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Ribul_P_3_epim PHP_C HcyBio CBS
Motif
Other DBs
NCBI-ProteinID: ACB08053
UniProt: B1L6H4
LinkDB All DBs
Position
1305270..1305899
Genome map
AA seq 209 aa AA seqDB search
MHMPLEVFLSLDLIHLEEALDIAEKARSAGFRCFEAGTPLIKSEGMRSVKLLRGRFPEAI
IFADTKTMDTGYLEATLAFSSGADIMSVMAVAPDETIREAVRRAREDGKEVIADTLGIRD
PETRIGRLIELDVDRICLHKGVDEGIFSEFDILEKIRGHGIKIGIAGGIDATTIRDVAKK
VDFVMVGRAVTKASDPRRAAEEILSAIKV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgccacttgaggtcttcctctctctggatctgattcacctagaggaagcgctt
gatatcgctgagaaggctagatcagcgggtttcaggtgttttgaagcgggaaccccgtta
ataaagtctgagggtatgagatccgttaagctcctcagagggagattcccagaggcgatt
atattcgctgatactaaaaccatggatacgggatatcttgaagccacgctggcattctca
tcgggagccgatataatgagcgtaatggccgtagctcccgatgagacgataagggaggca
gttagaagggctagagaagatggaaaggaggttatcgctgatactctaggtatcagggat
cccgagactaggatcgggaggctcatcgaactcgatgtagataggatatgcttacataag
ggtgtggatgaaggtatattctctgaattcgatatcttggagaagataaggggacatgga
ataaaaatagggatcgctggtggaatagatgccactactataagggatgtggctaagaaa
gtagattttgtgatggttggaagggcagtaacgaaagccagcgatcctaggagagctgct
gaagagatattatctgctattaaagtttag

DBGET integrated database retrieval system