KEGG   Candidatus Kinetoplastibacterium crithidii TCC036E: CDEE_0295Help
Entry
CDEE_0295         CDS       T02464                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kct  Candidatus Kinetoplastibacterium crithidii TCC036E
Pathway
kct00620  Pyruvate metabolism
kct00680  Methane metabolism
kct01100  Metabolic pathways
kct01120  Microbial metabolism in diverse environments
kct01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDEE_0295
  09102 Energy metabolism
   00680 Methane metabolism
    CDEE_0295
Enzymes [BR:kct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CDEE_0295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGF47377
UniProt: M1LNW3
LinkDB All DBs
Position
complement(76034..78865)
Genome map
AA seq 943 aa AA seqDB search
MYSEESRKSHLHSEIRLLGKILGNVIQECEGKRLFNTIETIRKVAINIEENSEILNNEKL
EKLINELDSNDTNYVARAFGFLLQLLNISEDLDQNRRQKEIDASSETMQRGSLKDIVQKL
IINNVTSSEISEILESSCIMPVLTAHPTEIQRRSILDSHWNIADKLSQRYLAQTNDEKND
IDYELTGYISMLWQTRMLRYSRLTVIDEIENALSYYKSTFLFAIPKLYNELINIINQKYN
KAVLPDSINPFLRMGSWIGGDRDGNPYVDEKTLKQAAIKQSTVILEHYLKEIYALKKELS
ISSLLIKVDDELLFLANRSGDESSHLIDEPYRRALIGIYSRLASTSKKLIGLNLARRDTI
QAHPYSNHEEFYKDLTIIHKSLVHNHGKTISALRLKKLRQSVRVFGFHLSTIDLRQNSDV
HERVLEELLQKAGVYLEGKNKYSELDEDLKVELLIKELNQGRPLLSPWINYSEETNKELN
ILKTAAEIRSLFGKQSIQHSIVSHTETLSDLLEVLLLQKETGLIPPIFSDTEQDNGLMIV
PLFETINDLQNSSKIMAAWLDIPEIKTRITNAQHNTQEVMLGYSDSNKDGGYLTSNWSLY
QAERSLVNVFNARGIKLRLFHGRGGSVGRGGGSSFDAIMSQPPGTVSGQIRLTEQGEVIQ
GKYNNAEVGKWHLELLTSATLESSLCIDRKIASQEDLHIKQFGDVMSSMSEYAQRLYCDL
VYLNPGFSEYFFSSTPINEISALNIGSRPSSRSKNQNIEDLRAIPWSFSWAQCRLMIPSW
YGIGSAIEHYIEFGNKSTTKSKQERLDQLRAMTKEWPAFKTLLSNMEMVLVKSNIKIASC
YSKLVKNEFLRSSIFNNISTEHDKTIKMLQLLTQRDLLEDNPTLLSRLNDRFVYIDPLNY
LQIELIKRYRSQQDYLSINEIEKIQRAIHLTINGIAAGLRNSG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgtactctgaagaatctcgaaaatcacatctacactctgaaataagattattaggaaaa
atcctaggaaatgttatacaagaatgtgaaggcaaaagactttttaacacaatagaaacc
ataagaaaagttgctatcaatatagaagaaaatagtgaaattcttaataatgaaaaatta
gaaaagctaatcaatgaattagatagtaatgacaccaactatgttgctagagcttttggg
tttttactacaattattaaatatatctgaggatttagatcaaaatcgtaggcaaaaagaa
atagatgcttcttcggaaacaatgcagagaggaagtttaaaagatattgtacaaaaacta
ataattaataatgtaacgtcatcggaaatttctgaaatattagaatcttcttgcataatg
cctgtacttacagcccatccaacagaaatacaacgcagaagtatcctagattcacactgg
aatattgcagataagctatctcagcgttatctggcccaaacaaatgatgagaaaaatgat
atagattatgagcttactggttatatttcaatgctctggcaaactagaatgcttcggtat
tcacgtctaacagtgatagatgagatagagaatgccttgtcttattacaaaagcactttc
ttatttgcaataccaaaactatacaatgaattaataaatattattaaccaaaaatacaac
aaagcagttctacctgattccattaatccttttctaagaatgggtagttggataggtgga
gatagagatggaaatccttatgtagatgaaaaaacattaaaacaagcagcaataaaacaa
tctactgttattcttgaacattacttaaaagagatatatgcattaaaaaaagaattatcc
ataagttcactcttgataaaagtagatgatgaacttttgtttcttgccaatagaagcgga
gatgaatctagtcatctgatagatgaaccttatcgtcgtgcattaataggaatttactca
agattagcttccacttcaaaaaaactaattggattaaatcttgctagaagagatactata
caagcccatccttattctaaccatgaagagttttataaagatctaactatcattcataaa
tcacttgttcataaccatggaaaaacaattagtgctctaagattaaaaaaattacgtcag
tctgtcagagtctttggcttccatctaagcactatagatttgagacagaattcagatgtg
cacgaaagagttcttgaagaactccttcaaaaagctggtgtatatctagaaggtaaaaat
aagtactcagaactagacgaagatttaaaagtagagcttctcataaaagaattaaatcaa
ggaagacctctcctatctccatggataaattatagtgaagaaacaaacaaagaactaaat
attttgaaaacagctgctgaaattagatctttattcgggaagcaatctatacaacactct
atagtatctcatacagaaacactaagtgatctattggaagttttattgttacaaaaagaa
actgggttaataccacctatatttagtgatactgaacaggacaatgggttaatgattgtc
cctttatttgaaacgataaacgacctgcaaaacagctctaaaattatggctgcatggcta
gatattccagaaataaaaacaagaattactaatgcacaacacaatactcaagaagtaatg
ttaggatactctgatagtaataaagatggaggatatttaacatcaaactggtctttatat
caagcagaaagatcattagttaacgtatttaatgctagaggcataaaacttaggctattc
catggacgaggaggatcagttggacgtggaggtggatctagttttgacgccataatgtct
caacctccaggaacggtatcaggtcaaattagattgacagaacaaggagaagttattcaa
ggaaaatataacaatgcagaagtaggaaaatggcatttggaactactaacctctgcaact
ctagaatcaagtttatgtatagatagaaagattgcctctcaagaagatttgcatatcaaa
caatttggcgacgttatgtcaagtatgtctgaatatgcacaaagactatattgtgattta
gtttatttaaatccaggcttctcagaatatttcttttcctcaactccaataaatgaaata
tcagctcttaatataggatcaagaccttcttctcgtagcaaaaatcaaaatatagaggac
ttaagagcaataccttggagtttttcctgggctcaatgtcgactaatgatacctagctgg
tatggaataggatctgctatagagcattatatagagtttggtaacaagtcaacaacaaag
tctaaacaagaaagacttgaccagttaagggccatgactaaagaatggcctgcattcaag
acattattatctaacatggaaatggtattagtaaaatctaatattaaaatcgcttcttgc
tactcaaaactagttaaaaatgaatttttaagaagcagcatatttaataatataagcacg
gaacatgataaaacaataaaaatgcttcaactactgacacaaagagatctattagaagat
aatcctactttgctatctagactaaatgatagattcgtatatattgacccattaaactat
ctacaaattgaattaattaaacgatatagatcacaacaagattacctatcaattaatgaa
atagaaaaaatacaacgagctatacacttaactattaatggaatagctgcaggattaaga
aattctggataa

DBGET integrated database retrieval system