KEGG   Candidatus Kinetoplastibacterium desouzaii: CDSE_0110Help
Entry
CDSE_0110         CDS       T02465                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
kde  Candidatus Kinetoplastibacterium desouzaii
Pathway
kde03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:kde00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CDSE_0110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kde03400]
    CDSE_0110
Enzymes [BR:kde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     CDSE_0110
DNA repair and recombination proteins [BR:kde03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CDSE_0110
 Prokaryotic type
     CDSE_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG Gb3_synth
Motif
Other DBs
NCBI-ProteinID: AGF47222
UniProt: M1LNF1
LinkDB All DBs
Position
756895..757665
Genome map
AA seq 256 aa AA seqDB search
MSNRLTSKDIYKNFELISCSWKEEISKYFSLNNLRNTFNFLENRLSEGIIIYPSNPFRAI
HITNTISKINIVIIGQDPYHNNGQANGLAFSINSNSHPPPSLKNIYKELSIEYKQFTFEK
EYNLISWANQGVLLLNNILTVEDSKPMSHKNKGWELFTDAIIKAVANDNNPKVFMLWGLQ
AQEKERIIKNQNNHHLILKANHPSPLSANRKPIPFIGCNHFINANRWLHLNKKNTIKWFF
SKKSVDCYQNLIYPQY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatagactaacatccaaagatatatataaaaattttgaattaattagctgctca
tggaaagaagaaatatcaaagtatttctcattaaacaatttgagaaatactttcaacttc
ttggaaaatagactttcagaaggaatcataatatatccatcaaatccttttagagcaata
catataacaaacacaatttctaaaattaatattgtaatcataggtcaagatccttaccac
aataatggacaagctaatggactggcattttctattaattcaaattcacaccctcctcct
agtctcaagaatatatataaagaactttctattgaatataaacaattcacttttgaaaaa
gaatataatttaatttcttgggctaaccaaggtgtattattattaaataatattttaact
gtagaagatagcaagccaatgtctcataaaaataaaggatgggaattatttacggacgct
ataataaaagctgttgcaaatgataacaatccaaaagtatttatgttatggggattacaa
gctcaagaaaaagaaagaataattaagaatcaaaataatcatcatttaatattaaaagca
aaccatccatccccattatctgccaatagaaaaccaatacctttcataggatgcaatcat
tttataaatgcaaatagatggttgcatttgaacaaaaaaaacactattaaatggtttttt
tctaaaaaatcagtagattgttatcaaaatttaatatatcctcagtactaa

DBGET integrated database retrieval system