KEGG   Dokdonia sp. 4H-3-7-5: Krodi_1277Help
Entry
Krodi_1277        CDS       T01484                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
kdi00010  Glycolysis / Gluconeogenesis
kdi00053  Ascorbate and aldarate metabolism
kdi00071  Fatty acid degradation
kdi00280  Valine, leucine and isoleucine degradation
kdi00310  Lysine degradation
kdi00330  Arginine and proline metabolism
kdi00340  Histidine metabolism
kdi00380  Tryptophan metabolism
kdi00410  beta-Alanine metabolism
kdi00561  Glycerolipid metabolism
kdi00620  Pyruvate metabolism
kdi00625  Chloroalkane and chloroalkene degradation
kdi01100  Metabolic pathways
kdi01110  Biosynthesis of secondary metabolites
kdi01120  Microbial metabolism in diverse environments
kdi01130  Biosynthesis of antibiotics
Module
kdi_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:kdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krodi_1277
   00053 Ascorbate and aldarate metabolism
    Krodi_1277
   00620 Pyruvate metabolism
    Krodi_1277
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Krodi_1277
   00561 Glycerolipid metabolism
    Krodi_1277
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Krodi_1277
   00310 Lysine degradation
    Krodi_1277
   00330 Arginine and proline metabolism
    Krodi_1277
   00340 Histidine metabolism
    Krodi_1277
   00380 Tryptophan metabolism
    Krodi_1277
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Krodi_1277
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Krodi_1277
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Krodi_1277
Enzymes [BR:kdi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Krodi_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEE19260
UniProt: F4B122
LinkDB All DBs
Position
complement(1441386..1442939)
Genome map
AA seq 517 aa AA seqDB search
MSTVAKDFGMDEALKILGISDINEGTSTGQKSFGNGDIIESYSPVDGQLIGKVKTTTKED
YEKVMTSATAAFKDFRTMPAPARGEMVRQFGNKLREVKEPLGKLVSYEMGKSYQEGLGEV
QEMIDICDFAVGLSRQLHGLTMHSERPGHRMYEQYHPLGVVGIISAFNFPVAVWAWNTAL
AWVCGDVCVWKPSEKTPLCGVACQNIIAEVLKANDMPEGISCLINGDYKVGEMMTTDKRV
PLISATGSTRMGKKVSATVGERLGTSLLELGGNNAIIVTPDADIKMTVIGAVFGAVGTAG
QRCTSTRRLIIHESMYDKVKDAVVKAYGQLRIGNPLDENNHVGPLIDTDAVANYNSALER
VVAEGGNLIVEGGVLSGEGYESGCYVKPAIAEASNDYEIVQHETFAPVLYLLKYKGDVMD
ALELQNGVAQGLSSAIMTNNLREAERFLSVAGSDCGIANVNIGTSGAEIGGAFGGEKDTG
GGRESGSDAWKVYMRRQTNTINYTTELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagtagcaaaagattttggaatggacgaagcgcttaaaatacttggcatttcc
gatataaatgaaggaacctctacaggtcaaaaaagttttggtaatggagacattatcgag
tcttattctccagtagatggacaattaataggtaaagtaaaaactaccacaaaggaagat
tacgagaaagtaatgacctctgcaactgcagcgtttaaagactttagaaccatgccagct
ccagcaagaggagagatggtacgtcagtttggaaataaacttcgtgaggtaaaagagcca
ttaggtaaactcgtttcttatgagatgggtaaatcatatcaagaaggactaggtgaagta
caagagatgatagacatctgtgactttgcagtaggtctttctcgacagttacacggtctt
acaatgcactcagaacgtcctggtcacagaatgtatgagcagtaccacccgctaggtgtg
gtaggtatcatttcggcatttaattttccggtagctgtttgggcttggaacacagcgctt
gcttgggtttgtggagatgtttgtgtatggaaaccatcagaaaaaacaccgctttgtggt
gttgcttgtcaaaacattattgcagaggttcttaaagctaacgatatgccagaaggtatc
tcttgccttataaacggagattacaaagtaggtgagatgatgactacagataagcgtgtc
cctcttatttctgctaccggttctactcgtatgggtaaaaaggtgtctgctacggtagga
gaacgtctaggaacatcactactcgaactagggggaaataatgcaatcattgtaactcca
gacgcagatattaaaatgacagtaatcggtgccgtttttggtgctgtaggaactgctgga
caacgctgtacatctactagacgtcttattatacatgagagtatgtatgataaagtaaaa
gacgccgtagtaaaagcatatggacagttacgcataggtaatcctcttgatgaaaataat
cacgtaggaccacttatcgatacggatgcagttgccaattacaacagcgcactagaacgt
gtggttgcagaaggtggtaaccttattgtagaaggtggagttcttagtggagaaggttat
gagagcggttgctacgtaaagccagcgattgcagaggctagtaatgattatgagattgta
caacacgagacttttgctcctgtattatacttattaaaatacaaaggtgatgtaatggat
gctttagagcttcaaaacggcgttgcacaaggactttcgtctgctattatgacaaacaat
cttcgcgaggcagagcgcttcttaagcgttgcaggatcagattgtggtattgcaaacgta
aacataggtacttctggtgcagagataggtggagcctttggaggtgagaaagacactgga
ggaggccgcgagtctggatcagatgcttggaaagtatatatgagaagacagactaacact
attaattacacgacagagcttccacttgcccaaggaattaaatttgacttatag

DBGET integrated database retrieval system