KEGG   Komagataeibacter europaeus: S101446_00372Help
Entry
S101446_00372     CDS       T04893                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
keu  Komagataeibacter europaeus
Pathway
keu00473  D-Alanine metabolism
keu01100  Metabolic pathways
keu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:keu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    S101446_00372
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    S101446_00372
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:keu01011]
    S101446_00372
Enzymes [BR:keu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     S101446_00372
Peptidoglycan biosynthesis and degradation proteins [BR:keu01011]
 Precursor biosynthesis
  Racemase
   S101446_00372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ARW15513
LinkDB All DBs
Position
complement(438021..439166)
Genome map
AA seq 381 aa AA seqDB search
MSDLPSFPHDTGWAAPGAGAMLEIDLDAIAANYRLLNARTGNSLCAAVVKADAYGLGAHR
VAPALEQAGANTFFVAHLEEGIRLRQHVAPTARIFVLHGPMPGTQAEFTRHDLLPVLNSM
EQVAGWRAHAGQMGNPLPAALQVDTGMSRFGLSDGDVTALAASPDLLDGIDTQLVMSHLA
CADTPANPANAMQRDRLRAMAGRLPAAPLALSASSGIFLGPDYHFDLVRPGAALYGLAPN
DDAPNPLRPTVRLGARIVQRRTINAGDGVGYGLTWRATGPRRIATLGIGYADGFLRRGAD
GGGCAWLGDYRLPILGRISMDSTTIDVTGVPEGVLAQATHVDMIGPRRSVDDVARSAGTI
GYEVLTALGSRFHRAYLTQAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctgccttccttcccgcatgataccggctgggccgcgccgggcgcgggtgcg
atgctggaaatcgacctggatgcgatcgcagcgaattaccgtctgctcaacgcccgcacg
ggcaactccctctgcgcggccgtggtcaaggcagacgcctacgggctgggcgcccaccgg
gttgcccccgcgctggaacaggccggggcgaataccttttttgtcgcccatctggaagaa
ggcatccgcctgcggcaacatgttgcccccaccgcacgtatttttgtcctgcatggcccg
atgccgggaacgcaggccgagttcacgcgccatgacctgctgccggtgttgaacagcatg
gaacaggtggccgggtggcgcgcgcatgcaggccagatgggcaatcccctgcccgccgcc
ctgcaggttgataccggcatgtcccgcttcggcctgtccgatggggatgtcaccgcgctg
gcggccagcccggacctgctggatggaatcgacacgcagctggtgatgagccaccttgcc
tgcgccgataccccggccaatcccgccaacgccatgcagcgcgaccgcctgcgcgccatg
gccgggcgcctgccagcggccccgctggcgctttcggcctcatcggggatcttccttggg
cctgattaccatttcgaccttgtgcggcccggtgcggcgctctatggcctggcgcccaac
gacgacgcgcccaatcccctgcgccccaccgtgcggctgggtgcgcgcattgtccagcgc
cgtaccatcaacgcgggcgacggcgtgggctatggcctgacatggcgcgccaccgggccg
cgccggatcgccacgctgggcatcggttatgccgacgggttcctgcgccgcggcgcagac
gggggcggatgtgcatggctgggggactaccggctgccgatccttggccgcatttccatg
gattccaccaccattgacgtgaccggcgtgcccgaaggcgtgctggcgcaggccacgcat
gtggacatgatcggcccgcgccgcagcgtggatgatgtcgcccggtccgccggcaccatt
ggctatgaagtgctgacggcgctgggttcccgtttccatcgcgcgtacctgacacaggcg
gcgtga

DBGET integrated database retrieval system