KEGG   Komagataeibacter europaeus: S101446_00473Help
Entry
S101446_00473     CDS       T04893                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
keu  Komagataeibacter europaeus
Brite
KEGG Orthology (KO) [BR:keu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    S101446_00473 (ahpF)
Enzymes [BR:keu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     S101446_00473 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like Thi4 FAD_oxidored AlaDh_PNT_C Glutaredoxin FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-ProteinID: ARW15614
LinkDB All DBs
Position
557475..559058
Genome map
AA seq 527 aa AA seqDB search
MLQDPIKTQLKGYLASLAHPIVLEASLDDTPASREMHELLHEVAALSDKVQVSETGQATR
RPSFVIRRDGAKTGVTFAAIPLGHEFTSFVLAMLQVGGHAPKIPDDVAAQIRALPGPYNF
ETYVALSCQNCPDVVQALNAMCVLNPNIHNVTIDGALFPDEVAARNIMSVPQVYLNGELF
ETGRMEIEQILAKLDADAPRRAAEKLKDVAPFDVLIIGEGPAGASAAVYAARKGLRTGLL
GDRFGGQVMDTAGIENFISIPETDGPKLAAALEAHVRQYDVDIIPGQRAKELFPATQPGG
LHGVVLESGAVLHSRTVILATGAHWRHLGVPGEEEYRNRGVAYCPHCDGPFYKGKRVAVA
GGGNSGVEAAIDLAGIVAHVTLLQRGSHLKADKVLQDKLHTLPNVTVLTEALTTRIEGNG
HNVTGLTYRGGDGADHHIDLEGVFVQIGLLPNTGWLKGTLKLNDFGEIIVNDHGATSIPG
VFAAGDATTTPYKQIVIAIGEGAKAALSAFDYLIRVPAPAPEKLVTA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagatcccatcaagacgcagctcaagggttatctggccagccttgcgcacccg
atcgtgctggaggccagcctggatgacacccccgcttcgcgtgagatgcatgaactcctg
catgaggtcgccgccctttcggacaaggtgcaggtgtccgagacagggcaggctacccgg
cggcccagcttcgtcatccgccgtgatggcgcgaaaacgggggtgacgttcgccgccatc
ccgctggggcatgagttcacctccttcgtgctggcgatgctgcaggtcggcggtcacgcg
ccaaagatccccgatgacgtggcggcccagatccgcgccctgccgggaccgtacaatttt
gaaacctatgtcgccctgtcgtgccagaactgccccgatgtggtgcaggcgctcaatgcg
atgtgcgtgctgaaccccaacatccacaacgtcacgattgacggggcgctgttccctgat
gaagtcgcggcgcgcaacatcatgtccgtgccgcaggtttacctgaacggtgaactgttc
gagacgggacgcatggaaatcgaacagatcctggcgaaactggatgccgatgctccgcgc
cgcgccgcggaaaagctgaaggatgtcgcgccgtttgatgtcctgatcattggcgaggga
cccgctggcgcatcggctgcggtgtatgccgcgcgcaaggggctgcgcacggggctgctg
ggcgaccgctttggcgggcaggtcatggataccgccggcatcgagaatttcatctccata
cccgaaaccgatggcccgaaactggctgcggcgctggaggcgcatgtccggcagtatgac
gtggacatcattcccggccagcgcgccaaggaactgttccccgccacccagcccggcggc
ctgcatggcgtggtgctggaaagtggcgcggtcctgcattcccgcacggtcatactggcc
accggcgcgcactggcggcaccttggcgtgccgggcgaggaggaataccgcaacaggggc
gtcgcctactgcccgcattgcgatggccccttctacaagggcaagcgcgtggccgtggcg
ggtggtggcaatagcggggtggaagcggccatcgatctggccggtatcgtcgcccacgtg
accctgctgcagcgcgggtcgcacctgaaggcggacaaggtattgcaggacaagctgcat
accctgcccaatgtcacggtcctgaccgaggccctgaccacgcggatcgagggcaacggc
cataatgtgaccggcctgacctatcgcggcggcgatggcgcggaccaccatattgatctg
gagggggtgttcgtgcagatcggcctgctgcccaacacgggctggctgaagggcacgctg
aagctgaatgactttggggaaatcatcgtcaatgaccacggtgccacctcgatccccggc
gtgttcgcggcgggcgatgcgacgaccacgccctataagcagatcgtcattgccataggc
gaaggggcgaaggcggcgctgtccgcctttgactacctgatccgcgtgcctgcgcctgca
ccggaaaagctggttacggcctga

DBGET integrated database retrieval system