KEGG   Kribbella flavida: Kfla_1287Help
Entry
Kfla_1287         CDS       T01155                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
kfl  Kribbella flavida
Pathway
kfl00020  Citrate cycle (TCA cycle)
kfl00270  Cysteine and methionine metabolism
kfl00620  Pyruvate metabolism
kfl00630  Glyoxylate and dicarboxylate metabolism
kfl00680  Methane metabolism
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01120  Microbial metabolism in diverse environments
kfl01130  Biosynthesis of antibiotics
kfl01200  Carbon metabolism
Module
kfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kfl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kfla_1287
   00620 Pyruvate metabolism
    Kfla_1287
   00630 Glyoxylate and dicarboxylate metabolism
    Kfla_1287
  Energy metabolism
   00680 Methane metabolism
    Kfla_1287
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Kfla_1287
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Kfla_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ADB30390
UniProt: D2Q476
LinkDB All DBs
Position
complement(1349577..1350569)
Genome map
AA seq 330 aa AA seqDB search
MSTTPVKVAVTGAAGQIGYSLLFRIASGALLGPDTPVELRLLEITPALKALEGVVMELDD
CAFPTLAKVEIGDDPNTIFDGANVALLVGARPRTKGMERGDLLEANGAIFTGQGKALNDH
AADDIRVTVTGNPANTNALIAKSNAPDIPAERFSALTRLDHNRALAQLAKKTGTSVNDLK
KLTIWGNHSATQYPDIFHAEVAGKNAAEVVNDQTWLENDFIPTVQKRGAAIIEARGASSA
ASAAAATIDHTRDWLRGSADGDWLSMAVVSDGSYGVPEGLISSFPVITKDGNWEIVQGLE
INDFSRGRIDASAAELAEERDAVQQLGLIG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactacccccgtgaaggtcgccgtcaccggcgccgccggccagatcggctacagc
ctgctgttccggatcgccagcggtgcgctgctgggcccggacaccccggtcgagctgcgg
ctgctggagatcaccccggcgctgaaggcgctggagggggtcgtgatggagctcgacgac
tgcgcgttcccgacgctggccaaggtcgagatcggcgacgacccgaacaccatcttcgac
ggcgcgaacgtcgccctgctggtcggcgcccggccgcggaccaagggcatggagcgcggt
gacctgctcgaggccaacggcgcgatcttcaccggccagggcaaggcgctgaacgaccac
gccgccgacgacatccgggtcaccgtcaccggcaacccggccaacaccaacgcgctgatc
gccaagagcaacgcgccggacatcccggccgagcggttctccgcgctgacccggctggac
cacaaccgcgcgctggcacagctggccaagaagaccggcaccagcgtcaacgacctgaag
aagctgacgatctggggcaaccactcggccacccagtacccggacatcttccacgccgag
gtggccggcaagaacgccgccgaggtcgtcaacgaccagacctggctggagaacgacttc
atcccgaccgtgcagaagcgcggcgcggcgatcatcgaggcccgcggcgcctcctcggcc
gcgtcggccgcggcggccacgatcgaccacacccgcgactggctgcgcgggtcggccgac
ggcgactggctgtcgatggcggtcgtgtccgacggctcgtacggcgtaccggaggggctg
atctcgtcgttcccggtgatcaccaaggacggcaactgggagatcgtgcagggcctggag
atcaacgacttctcccgcggccggatcgacgccagtgccgccgagctcgccgaggagcgc
gacgcggtccagcagctcggcctgatcggctga

DBGET integrated database retrieval system