KEGG   Kribbella flavida: Kfla_1532Help
Entry
Kfla_1532         CDS       T01155                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
kfl  Kribbella flavida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase DNA_ligase_A_C DUF3220 PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: ADB30630
UniProt: D2PLK1
LinkDB All DBs
Position
1622525..1623532
Genome map
AA seq 335 aa AA seqDB search
MGKLAADLLGPVGLELARAVDQLPGEHAMPGGSRFELKWDGYRVGVVCRGGEVRLWSRNG
KDFTAKFPDVQAALQAQLGTDCVLDGELVVWNGERLDFDALQQRMVNTVTTVRRKLAPAF
PAAFVAFDVLAVGGVDVRPMRWTARRARLERLAQGWRPPLQVSPATADVEEAKEWLEAFK
ASGVEGLVVKGASSRYQPGRRDWVKVKFRETVDVIVGAVTGSVQRPEVLVVGRYRGRELE
VIGRTTTLKAAQAEAVGRLLRPAGQRHPWPDEISTHWGRGSRTPIIKVQPKVVVEVAADA
ALQAGHYRHPLRLVRHRAELQTEDVPTLPDSAADE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagctggcggccgatttgctcgggccggtcggattggagctggcccgggcggtc
gaccagctgcccggtgagcacgccatgcctggaggttcgaggttcgagctgaagtgggac
ggctaccgggtcggcgtggtgtgccggggtggcgaggtgcggttgtggtcccggaacggg
aaggacttcaccgcgaagttccccgacgtccaggcggcgctccaggctcagctgggaacc
gactgcgtgctggacggcgagctggtggtgtggaacggggagcggctcgacttcgacgcg
ttgcagcagcgcatggtcaacacggtgacgacggtacggcggaagctggcgccggcgttt
ccggcggcgttcgtggcgttcgacgtactggcggtcggcggcgtcgacgtacggccgatg
cggtggacggcccggcgggcccggctggagcgcctcgcccaagggtggcggccgccgctg
caggtgtcgccggccacggctgatgtcgaggaagcgaaggaatggctggaggcgttcaag
gccagcggagtggaaggcctggtcgtgaagggtgcgtcgagccggtaccagccggggcgg
cgggactgggtcaaggtgaagttccgggagaccgtcgacgtgatcgtcggcgcggtcacc
ggatcggtgcagcggccggaggtgctggtcgtcgggcggtaccgcggtcgcgagctcgag
gtgatcggccggacgacgacgctgaaagccgcccaggccgaggccgtcggccggttgctg
agaccggcgggccaacggcacccgtggcccgacgagatcagcacccactggggccggggc
agccggaccccgatcatcaaggtgcagcccaaggtcgtggtggaagtcgcggccgacgcc
gccctgcaggccgggcactaccgccatccactccgcctggtccggcaccgggcggagttg
cagacagaagacgtcccgacacttcctgatagtgctgcggacgagtga

DBGET integrated database retrieval system