KEGG   Kribbella flavida: Kfla_1537Help
Entry
Kfla_1537         CDS       T01155                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kfl  Kribbella flavida
Pathway
kfl00020  Citrate cycle (TCA cycle)
kfl00480  Glutathione metabolism
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01120  Microbial metabolism in diverse environments
kfl01130  Biosynthesis of antibiotics
kfl01200  Carbon metabolism
kfl01210  2-Oxocarboxylic acid metabolism
kfl01230  Biosynthesis of amino acids
Module
kfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kfl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kfla_1537
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Kfla_1537
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Kfla_1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF4115 DUF3322 FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ADB30635
UniProt: D2PLK6
LinkDB All DBs
Position
complement(1627568..1629787)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVIQAYAAQAGVAVETRDISLAGRIVALFGEYLREDQ
RITDDLGELGELAKTPAANIIKLPNVSASIPQLKAAIAELQSQGYALPDYPDEPKTDEER
EIQARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTPDNKTNVATMGTDD
FRSTEKSAVIPADTTLRIELTGDDGSTTVLRESVPVLAGEVVDASVMHVAPLREFLTAQV
ARAKAEDVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFASYGETLAKAGLTPNDGLGGI
LAGLAALPEGPAIKASFDAELADGPQLAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEHDTLAVLPDSSYAGIYQVVLDDCRANGAFDPATMGSVPNVGLMAQKAEEYGS
HDKTFEVPTTGTVRVVDADGTVVLEQTVSAGDIFRACQTKDAPVRDWVKLAVTRARATGD
PAVFWLDETRPHDANLIAKVNEYLTEHDTDGLALRILPPVEAIAFSLERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALAASFEHLAQTTGNARAQVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELAKQTDDADLATTFAPLAETLAGNEQTIVEELLAVQGNPVELGGYYHPDPAL
AAAAMRPSKTWNDALATLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacactgacgaggcgccggcgctggccacctac
tcgttcctgccggtgatccaggcgtacgccgcccaggccggtgtcgcggtggagacccgg
gacatctcgctcgcgggccggatcgtcgcgctgttcggcgagtacctgcgcgaggaccag
cggatcaccgacgacctcggcgagctgggcgagctggccaagacacccgcggcgaacatc
atcaagctgccgaacgtgtcggcctcgatcccccagctgaaggccgcgatcgccgagctg
cagagccagggctacgcgctgccggactaccccgacgagccgaagaccgacgaggagcgg
gagatccaggcccgctacgacaaggtcaagggctccgcggtgaacccggtcctgcgcgag
ggcaactccgaccgccgcgcgcccgcctcggtgaagaactacgccaagacccacccgcac
cggatgggcgcctggaccccggacaacaagaccaacgtcgccacgatgggcaccgacgac
ttccgctcgaccgagaagtcggccgtgatccccgccgacaccacactgcggatcgagctg
accggcgacgacggctcgaccacggtgctgcgcgagtcggtcccggtgctggccggtgag
gtcgtcgacgcctccgtcatgcacgtcgcgccgctgcgggagttcctcaccgcgcaggtg
gcccgggccaaggccgaggacgtgctgttctcggtgcacctgaaggccaccatgatgaag
gtctccgacccgatcgtcttcggccacgtggtccgggcgttcttcccgaagaccttcgcg
tcgtacggcgagacgctggccaaggccggcctcaccccgaacgacggcctcggcggcatc
ctggccggactggccgcgctgcccgaggggcctgcgatcaaggcctccttcgacgccgag
ctggccgacggcccgcagctggcgatggtcgactccgacaagggcatcaccaacctgcac
gtgccgtccgacgtcatcgtcgacgcctcgatgccggcgatgatccgcacctccggccac
atgtggggcccggacggccaggagcacgacacgctggccgtgctgccggacagcagctac
gccggcatctaccaggtcgtgctggacgactgccgcgccaacggagccttcgacccggcc
acgatgggctcggtgccgaacgtcggtctgatggcccagaaggccgaggagtacggcagc
cacgacaagaccttcgaagttcccaccaccggcaccgtccgggtggtcgacgccgacggc
actgtcgtgctcgagcagaccgtctcggccggcgacatcttccgcgcctgccagaccaag
gacgcgccggtccgcgactgggtcaagctggccgtcacccgggcccgcgccaccggcgac
ccggcggtgttctggctggacgagacgcgcccgcacgacgcgaacctgatcgccaaggtg
aacgagtacctgaccgagcacgacaccgacggcctggccctgcgcatcctgccgccggtg
gaggcgatcgcgttctcgctggagcggatccggcgcggcgagaacaccatctcggtgacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctcgagctcggcaccagt
gccaagatgctgtcggtcgtgccgctgatggccggcggcggtctgttcgagaccggtgcg
ggcggttccgcgccgaagcacgtgcagcagctggtcaaggagaactacctgcgctgggac
agcctgggcgagttcttcgcgctggccgcgagcttcgagcacctggcccagaccaccggc
aacgcccgcgcccaggtgctggccgacaccctggaccgggccaccgcgacgttcctgaac
gaggacaagtccccgacccggcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggccaagcagaccgacgacgccgacctggccacg
acgttcgctccgctcgccgagacgctcgcgggcaacgagcagaccatcgtcgaggaactg
ctcgccgtccagggcaaccccgtcgagctcggcggctactaccaccccgacccggccctg
gccgccgcggcgatgcgcccctccaagacctggaacgacgcgctcgccaccctggcctga

DBGET integrated database retrieval system