KEGG   Kribbella flavida: Kfla_1817Help
Entry
Kfla_1817         CDS       T01155                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kfl  Kribbella flavida
Pathway
kfl00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Kfla_1817
Enzymes [BR:kfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Kfla_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4434 DUF3459 Glyco_hydro_2_C ThuA DUF4159 DUF4350
Motif
Other DBs
NCBI-ProteinID: ADB30911
UniProt: D2PPE9
LinkDB All DBs
Position
1910024..1912054
Genome map
AA seq 676 aa AA seqDB search
MSFTGNGAGPAGWLPGVSAISYGGDYNPEQWPEESWPGDIELMRQAGVNLVSIGIFSWAL
IEPRRGEHDFGWMDRLFELLHAAGIRISLGTPTASPPAWFFHEHPEARVVTRDGTTLGFG
SRGMASPSSPAYREASVSIATALARRYGNHPALAVWHVHNEYGAPVSECYSEQSVRAFRR
WLQGRYESLDALNAAWGTAFWGQRYLEWQHISAPAVSASVVNPAQRLDFARFTSDALLQC
FVAERDAIRAECPQVPITTNFMAGTCESVDLWKWADAVDIVANDHYLVAEDPRSHVGLAL
SADLTRSLARGKPWILMEHSTSGVNWQPRNLAKRSGELARNALTHFGRGADAVMFFQWKA
SRSGAEKFHSAMVPHAGTRSRIWSEVCALGAGLGTLGEVLGSTVSAEAAVLWDWESFWAQ
DLEWRPSEDLSHRERVNAFYDRLWRDQLTVDFAHPEADLAAYKLVVAPASYLLTRAAADN
LRRYVEGGGTLVVSYFSAIVDEHDAVHDGGFVAPLRDVLGLTVEEFLPLRAGETVRLTPS
EVVGDVWTDDVALEGAEVVAAFEDGPAAGKPAITRNTLGAGAAWYVATRLDADQLAVVLE
GAYRDAGLTPGDGPEDLELVRRRHADAEYLIAVNHGTKPADLPVGGTDLLTGEAGASLKV
EAGGVRVLRTDRHQER
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttcacgggtaacggggccgggccggcgggctggcttccaggcgtgtccgcgatc
agctacggcggcgactacaaccctgagcagtggcccgaggagagctggcccggcgacatc
gagctgatgcggcaggccggggtcaacctggtcagcatcgggatcttctcctgggccctg
atcgagccgcggcgcggtgagcacgacttcggctggatggaccggctgttcgagctgctg
cacgcggccggcatccggatcagcctcggtacgccgaccgcctcgccgcccgcatggttc
ttccacgagcaccccgaggcccgggtggtcacccgcgacggaacgacgctcggcttcggc
tcgcgcggcatggccagcccgagctcgccggcgtaccgggaggcgagcgtctcgatcgcg
accgcgctggcacggcgctacggcaaccatcccgcgctcgccgtctggcacgtgcacaac
gagtacggcgcgccggtctcggagtgttactccgagcagagcgtccgggcctttcggcgc
tggctgcagggccggtacgagtcgctggacgcgctcaacgcggcttgggggaccgcgttc
tggggccagcggtacctcgagtggcaacacatctcggccccggcggtctcggccagcgtg
gtgaacccggcccaacggctcgacttcgcacgcttcacctccgacgcgctgctgcagtgt
ttcgtcgccgagcgggacgcgatccgggccgagtgcccgcaggtcccgatcaccaccaac
ttcatggccggcacctgcgagtccgtcgacctgtggaagtgggccgacgcggtggacatc
gttgccaacgaccactacctggtcgcggaggacccgcgcagccacgtcgggctggcgctc
tcggccgacctgacccgctccctcgcgcgcggcaagccgtggatcctgatggagcactcg
acgtccggtgtgaactggcagccgcgcaacctggcgaagcggtccggtgagctggcccgc
aacgcgctcacccacttcggtcggggtgccgacgcggtgatgttcttccagtggaaggcg
tcccgctcgggggcggagaagttccactcggcgatggttccgcacgccgggacccggagc
cggatctggtcggaggtgtgcgcgctcggggccggtctcggcacgctgggcgaggtgctc
gggtcgacggtgtcggccgaggccgcggtgctgtgggactgggagtcgttctgggcgcag
gacctggagtggcggccgagcgaggacctgtcccaccgggaacgggtgaacgccttctac
gaccggctgtggcgggaccagctgaccgtcgacttcgcgcatccggaggccgacctcgcg
gcgtacaagctggtggttgccccggcctcctacttgctgacccgggccgcggcggacaac
ctgcgcaggtacgtcgaaggcggcggcacgctggtcgtgtcgtacttctcggcgatcgtc
gacgagcacgacgcggtgcacgacggtgggttcgtcgccccgctgcgcgacgtgctgggg
ctgaccgtcgaggagttcctgccgttgcgggcgggggagacggtgcggctcacgccgtcg
gaggtcgtcggtgacgtgtggaccgacgacgtcgcgctggaaggcgccgaagtcgtggcg
gcgttcgaggacgggccggcggcgggcaagccggccatcacccgcaacaccctcggcgcg
ggcgccgcctggtacgtggcgacgcggctcgacgccgaccagttggccgtcgtactggag
ggtgcgtaccgggatgcgggcctcaccccgggcgacgggccggaggatctcgagctggtc
cgccggcggcacgcggacgccgagtacctgatcgctgtgaaccacggaaccaagccggcc
gacctgcccgtcggcggcaccgatctgctcaccggggaggcgggtgcgtcgctgaaggtc
gaggccggcggcgtccgtgtcctgcgaaccgaccgacaccaggagcgctga

DBGET integrated database retrieval system