KEGG   Kribbella flavida: Kfla_3197Help
Entry
Kfla_3197         CDS       T01155                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kfl  Kribbella flavida
Pathway
kfl00564  Glycerophospholipid metabolism
kfl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Kfla_3197
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Kfla_3197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GMC_oxred_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADB32260
UniProt: D2Q4E6
LinkDB All DBs
Position
3412664..3414376
Genome map
AA seq 570 aa AA seqDB search
MGVVALSPQARSEAIDAMADGRELDVLVIGGGVVGAGSALDAATRGLTTGLLEARDFASG
TSSRSSKLVHGGLRYLEMLDFRLVHEALQERGLLLQRLAPHLVKPVPFLYPLQHRWWERL
YAGAGVALYDAMAVSSGLGAGLPIHRHLTRRGAMRLVPSLKKSALVGALQYYDAQVDDAR
HTMELARTAASYGAHVANRVKVTGFLRQGERVTGVQAKDLESGREFEVRAKQVVNATGVW
TDDTQAMVGERGQYHVRASKGIHLVVPKDRIQSSTGMILRTEKSVLFVIPWGRHWLIGTT
DTDWNLDKAHPAATSKDIEYLLEHVNSVLTTPLTREDVEGVYAGLRPLLAGESESTSKLS
REHVVAHAAPGLVVVAGGKYTTYRVMAKDAIDAVANALDGRVPKCTTKTIPLVGADGYTA
LWNQRHLIAQRSGLHVARIEHLLNRYGALIEEVLALVEQDPSLGEQLPGTQDYLKAEVVY
AARSEGARHLDDVLARRTRISIEVWDRGVEAAEAAARLMAPVLGWDEETTQREVSFYIKR
VRSERDSQDQPDDESADKVRLEAPDIVSPV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtagtggctctgtccccgcaagcgaggtcggaggccatcgacgcgatggccgac
ggccgcgaactggacgtcctggtgatcggcggcggggtggtcggcgccggctcggccctg
gacgccgcgacccggggcctgaccaccgggctgttggaggcccgcgacttcgccagtggc
acctccagccgttcgagcaagttggtgcacggcggtctgcgatacctggagatgctcgac
ttccggctggttcacgaggcgttgcaggagcgcggcctgctcctgcaacgcctggcgccg
cacctggtgaaaccggtgccgttcctctacccgctccagcaccgctggtgggagcggctg
tacgccggcgcgggcgtcgccctgtacgacgcgatggcggtcagctcgggcctcggcgcg
ggcctgccgatccaccggcacctgacccggcgcggagcgatgcggctggtgccgagcctg
aagaagtcggcgctggtcggcgcgttgcagtactacgacgcccaggtcgacgacgcccgg
cacacgatggagctggcccgcaccgccgcgtcgtacggcgcgcacgtggcgaaccgggtc
aaggtcaccgggttcctccggcagggcgagcgggtcaccggcgtgcaggccaaggacctg
gagagcgggcgcgagttcgaggtccgggccaagcaggtggtgaacgcgaccggggtgtgg
accgacgacacccaggcgatggtcggcgagcgcgggcagtaccacgtgcgcgcgtcgaag
ggcatccacctggtggtgccgaaggaccggatccagtccagcaccgggatgatcctgcgg
accgagaagtcggtgctgttcgtgatcccgtggggccggcactggctgatcggcaccacc
gacaccgactggaacctggacaaggcgcacccggcggcgaccagcaaggacatcgagtac
ctgctcgagcacgtcaactcggtgctgaccaccccgctgacccgcgaggacgtcgagggc
gtgtacgccgggctgcggccgctgctggcgggggagtcggagagcacgtcgaagctgtcc
cgcgagcacgtcgtcgcgcacgccgcgcccggcctggtcgtggttgccggtggcaagtac
acgacgtaccgggtgatggccaaggacgcgatcgacgcggtcgcgaacgcgctggacggg
cgggtgccgaagtgcaccacgaagacgatcccgctggtcggcgccgacgggtacaccgcg
ctgtggaaccagcggcacctgatcgcgcagcggtccgggctgcacgtggcccggatcgag
catctgctcaaccggtacggcgcgctgatcgaggaggtgctcgcgctggtcgagcaggac
ccgtcgctgggtgagcagctgcccggcacgcaggactacctgaaggccgaggtggtgtac
gccgcccgctcggagggtgcgcggcacctggacgacgtgctggcccggcgtacgcggatc
tcgatcgaggtgtgggatcgcggcgtcgaggcggccgaggccgcggcccggttgatggcg
ccggtcctgggctgggacgaggagacgacgcagcgggaggtctccttctacatcaagcgg
gtccggtccgagcgcgactcccaggaccagcccgacgacgagtccgccgacaaggtccgc
ctggaggccccggacatcgtctccccggtgtga

DBGET integrated database retrieval system