KEGG   Kribbella flavida: Kfla_3713Help
Entry
Kfla_3713         CDS       T01155                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
kfl  Kribbella flavida
Pathway
kfl00061  Fatty acid biosynthesis
kfl00780  Biotin metabolism
kfl01100  Metabolic pathways
kfl01130  Biosynthesis of antibiotics
kfl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Kfla_3713
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Kfla_3713
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Kfla_3713
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kfl01004]
    Kfla_3713
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Kfla_3713
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Kfla_3713
Lipid biosynthesis proteins [BR:kfl01004]
 Fatty acid synthase
  Component type
   Kfla_3713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ADB32768
UniProt: D2PNV0
LinkDB All DBs
Position
complement(3995096..3995866)
Genome map
AA seq 256 aa AA seqDB search
MGILDGKRILVAGVTLDSSIGFATAKVAQEQGATVLISNFGRALSITRRIAKRLPQEPPV
LELDVTDAEHLAALPDRIREHVDGLDGVVHSIAYGNPETILGGKFLDGPWDDVSRAVHVS
AYSLKALAVTCAPLMSRGGSIVGLTFDATVAWPGYDWMGVAKAALESTSRYLARDLGPQG
IRCNLVSAGPLKTLAAKAIPGFEKFEEPWLDRAPLGWDPSDLAPTGRTIVGLLSDFFPAT
TGEIVHVDGGYHAMGA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgggcatcctcgacggcaagcggatcctcgtcgccggagtcacgctcgactcctcgatc
ggtttcgccaccgccaaggtcgcgcaggaacagggcgcgaccgtgctgatctcgaacttc
ggccgcgcgctgagcatcacccggcggatcgcgaaacgcctgccgcaggaaccgccggtg
ctcgagctcgacgtgaccgacgccgagcacctggccgctctgccggaccggatccgcgag
cacgtggacggcctggacggcgtcgtgcactccatcgcgtacgggaacccggagacgatt
ctcggcggcaagttcctggacggcccgtgggacgacgtgtcccgcgcggtgcacgtctcg
gcgtacagcctcaaggcgctggcggtgacctgcgcgccgctgatgagccgcggcggcagc
atcgtcgggctcaccttcgacgccaccgtggcgtggccgggctacgactggatgggggtg
gccaaggccgcgctggagtccacctcgcgctacctggcgcgtgacctcggcccgcagggg
atccgctgcaacctggtctcggccgggccgctgaagacgctggccgccaaggcgatcccg
gggttcgagaagttcgaggagccgtggctggaccgggccccgctgggctgggacccgtcc
gacctggcgccgaccggcaggacgatcgtcgggctgctcagcgacttcttcccggccacc
accggcgagatcgtgcacgtcgacggcggctaccacgcgatgggtgcctag

DBGET integrated database retrieval system