KEGG   Kribbella flavida: Kfla_4705Help
Entry
Kfla_4705         CDS       T01155                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
kfl  Kribbella flavida
Pathway
kfl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Kfla_4705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kfl03400]
    Kfla_4705
Enzymes [BR:kfl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Kfla_4705
DNA repair and recombination proteins [BR:kfl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Kfla_4705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADB33722
UniProt: D2PZB3
LinkDB All DBs
Position
complement(5073483..5074439)
Genome map
AA seq 318 aa AA seqDB search
MPPVLPMMAALGVMPTGADWAYELKWDGIRVIAEVDADGCRLWSRNSRDVSGGYPELLGL
AEAPGLQLPAVLDGEIVTLDENGAPSFGLLQRRMHVRDPRQLAQLVVQVPVSVRVFDILR
FDGKSLLEATYDERRALLESLDIDDPFWEVPQAYPDGEQALDLSASTGLEGVVAKRRKSR
YLPGKRSSDWIKVKPVLTRDVVLCGWHPGEGNRAGRIGSLYCGAYAEPGGDLVLIGKVGS
GLDFAMLDLLGAELAGLEIDRPPFDASSIPGTDRRAAHWLDPLLVAEVTYSGWAADGRLR
HPVWRGLRLDIDPESVLV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccggtgctgccgatgatggccgcgctcggggtgatgccgaccggcgcggactgg
gcgtacgagttgaagtgggacggcatccgggtgatcgccgaggtggacgccgacggctgc
cggctctggtcgcgcaacagccgggacgtctccggcggctatcccgagctcttgggcctg
gccgaggcgccggggctgcaactgcccgcggtgctggacggggagatcgtcaccctcgac
gagaacggcgccccgtcgttcgggctgctgcagcggcgcatgcacgtccgcgatccgcgc
cagctggcccagctggtcgtccaggtcccggtgtcggtgcgcgtcttcgacattctccgg
ttcgacggcaagtccttgctcgaggcaacgtacgacgagcgccgggcgctgctcgagtcg
ctcgacatcgacgacccgttctgggaggtgccgcaggcgtatcccgacggtgagcaagcg
ctcgacctgtcggcgtccaccggcctggaaggtgtggtcgccaaacgccgcaagtcgcgt
tacctgccgggcaagcgcagctccgactggatcaaggtgaagccggtcctgacccgcgac
gtcgtgctgtgcggctggcatccgggggagggcaaccgggccggccggatcggttcgctc
tactgcggcgcgtacgccgagcccggcggcgacctggtcctgatcggcaaggtcggctcc
ggcctcgacttcgccatgctcgacctgctcggcgcggagctggccggcctggagatcgac
cggccgcccttcgacgcctcctccatccccggcaccgaccggcgcgctgcgcactggctc
gacccgctgctggtcgccgaggtcacctactccggctgggccgcggatggccgccttcgc
cacccggtctggcgcggcctccgcctcgacatcgatcccgagtcggtgctcgtctga

DBGET integrated database retrieval system