KEGG   Kribbella flavida: Kfla_4734Help
Entry
Kfla_4734         CDS       T01155                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kfl  Kribbella flavida
Pathway
kfl00250  Alanine, aspartate and glutamate metabolism
kfl00410  beta-Alanine metabolism
kfl00640  Propanoate metabolism
kfl00650  Butanoate metabolism
kfl01100  Metabolic pathways
kfl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Kfla_4734
   00650 Butanoate metabolism
    Kfla_4734
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Kfla_4734
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Kfla_4734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kfl01007]
    Kfla_4734
Enzymes [BR:kfl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Kfla_4734
Amino acid related enzymes [BR:kfl01007]
 Aminotransferase (transaminase)
  Class III
   Kfla_4734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADB33751
UniProt: D2PZE2
LinkDB All DBs
Position
complement(5105113..5106402)
Genome map
AA seq 429 aa AA seqDB search
MTHAELWERHRAVMPDWLALYYEEPIEIVSGSGRRVTDGEGNQYLDFFAGILTNAIGYDV
AEISDAVREQLATGVAHTSTVYLIRRQIELAERIAELSGIKEAKVFFTNSGTEANEAALL
LATQQRRSNQVLAMRNSYHGRSFGTIAITGHRGWSASSLSPVNVQYVQGAYRYRSPFRDL
PDAEYIKVCVEDLRTVIDTTTSGDVACLIAEPIQGVGGFASPPDGLFAAFKEVLDEYGIL
LISDEVQTGWGRTGEHFWGIQAHDVVPDAMTFAKGLGNGFAIGGVVATPAMMDSLSANSL
STFGGNPIATTAAKATLEYLLDKDLQANAAKRGAQLADGLRGIADEFPELGDVRGKGLML
AAEIVRPDDRVPDAATTAKLQQEAKNRGLLIGKGGLYGNVLRMAPPMTLTEPETTEAIEI
LRDSFNTLR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacacatgcggagctgtgggagcgtcaccgggccgtgatgccggactggttggccctg
tactacgaggagccgatcgagatcgtcagcgggtccggccgccgggtcaccgacggcgag
ggcaaccagtacctcgacttcttcgccggcatcctgaccaacgcgatcgggtacgacgtg
gcggagatctccgacgcggtccgcgagcagctggccaccggggtcgcgcacacctcgacc
gtgtacctgatccggcggcagatcgagctggccgagaggatcgccgagctgtccgggatc
aaggaggccaaggtcttcttcaccaactccggcaccgaggcgaacgaggcggcgctgctg
ctcgccacccagcagcgccggtcgaaccaggtgctcgcgatgcgcaactcgtaccacggc
cgcagcttcggcacgatcgcgatcaccggtcaccgcggctggtccgcgagcagcctgagc
ccggtcaacgtgcagtacgtgcagggcgcgtaccgctaccgcagcccgttccgcgacctg
ccggacgccgagtacatcaaggtctgcgtcgaggacctgcggaccgtgatcgacaccacc
acctccggggacgtggcctgcctgatcgccgagccgatccagggggtcggcgggttcgcc
tcgccgccggacgggttgttcgcggcgttcaaggaggtgctcgacgagtacggcatcctg
ctgatctccgacgaggtccagaccgggtgggggcggaccggcgagcacttctggggtatc
caggcgcacgacgtcgtacccgacgcgatgacgttcgccaaggggctcggcaacgggttc
gcgatcggtggggtggtggcgacgccggcgatgatggacagcctgagcgccaactcgctg
tcgaccttcggcggcaacccgatcgccaccaccgcggcgaaggcgacgctcgagtacctg
ctcgacaaggacctgcaggcgaacgcggccaagcgcggtgcgcagctcgccgacgggctg
cggggcatcgccgacgagttccccgagctgggggacgtgcggggcaaggggttgatgctg
gcggcggagatcgtgcgccccgacgaccgcgtgccggacgcggcgaccacggcgaagctg
cagcaggaggcgaagaaccgcggcctgctgatcggcaagggcggtctctacggcaacgtg
ctgcggatggcgccgccgatgacgctcaccgagccggagaccacggaggcgatcgagatc
ctcagggactcgttcaacacccttcgctga

DBGET integrated database retrieval system