KEGG   Kribbella flavida: Kfla_5280Help
Entry
Kfla_5280         CDS       T01155                                 

Definition
(GenBank) Laminin G sub domain 2
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
kfl  Kribbella flavida
Pathway
kfl00511  Other glycan degradation
kfl00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Kfla_5280
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Kfla_5280
Enzymes [BR:kfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Kfla_5280
Bacterial toxins [BR:kfl02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Kfla_5280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR Laminin_G_2 BNR_3 DUF4185 Laminin_G_1
Motif
Other DBs
NCBI-ProteinID: ADB34294
UniProt: D2PL39
LinkDB All DBs
Position
complement(5693173..5694987)
Genome map
AA seq 604 aa AA seqDB search
MPTPLRLMLALVLVLPALTATTAGARPMAEPAAVVQTVLFDKGGAGYGCYRIPAIVRTKA
GTLLAFAEARRTWCGDSQEIDLVMRRSTDNGRTWSAQKVVLSGTDTDPNAVATRGNPTPI
VDYQTGRIVLLTTMDPGNGTDRPRTPYVQFSEDDGLTFSKARSIGGQIDDPAWGWYATGP
VHGIQLTRGAHQGRLVAGTNYDVSGKHAGQLVYSDDSGETWHKGATDLRSDGLVPQEISV
VEKVDGGIYAGARNNGGSAGNSRAFAVSNDGGESYVAPYAPVVGLTTPTVQGSLVRLRAT
DQGAKYNRILFASPADPERRRYLTIRSSFDEGRTWQTVEQGTRITSDWSGYSDMAVLGTG
EIGLLYEGGTVDARDQIRFARFTETDIGHPDGASGPTTPDVSGLGNHSYLRGGTTAVAGR
FGQARDLDGTDDAIQLPYAESLALGSGDFTAMAWIRYGASTASQAIFWGYGINEFSQFWL
RAEPASSRIRGLITVNGSTAAVASTRAYNDNAWHHVALQRKAGTLSLWVDGAQVGSVAAP
SGSISPGRPFRMYVGQRLDGLHRFDGSLDEVRIYKRALTAAEIASIRTSNVTTVPNVVLD
LPLG
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcccacacctctccgcctgatgcttgctctcgttcttgtgctcccggcgctcacggcg
accaccgccggcgcccgtccgatggccgagcctgctgccgtcgtccagaccgtgctgttc
gacaagggtggcgccggctacggctgctaccggatcccggccatcgtccggaccaaggcc
ggaacgctgctcgccttcgccgaagcgcggcggacgtggtgcggcgactcgcaggagatc
gacctggtgatgcgccgctccaccgacaacggccgaacctggtcggcgcagaaggtggtg
ctgtcgggcaccgacaccgacccgaacgccgtggccacccgcggcaacccgacgccgatc
gtggactaccagaccggccggatcgtgctgctgaccaccatggatcccgggaacgggacg
gatcgcccgcgcacgccgtacgtgcagttcagcgaggacgacggcctgacgttcagcaag
gcccgcagcatcggcggccagatcgacgacccggcctggggctggtacgcgaccgggccg
gtgcacggcatccagttgacccgcggcgcgcaccagggccgcctggtcgccggcacgaac
tacgacgtgagcggcaagcacgccggtcagctcgtctacagcgacgacagcggcgagacc
tggcacaagggtgcgaccgatctgcgctccgacggactggtgccgcaggagatcagtgtg
gtggagaaggttgacggcggcatctacgcgggcgcccggaacaacggcggcagcgccggc
aacagccgggcctttgctgtcagcaacgatggcggcgagagctacgtcgcgccgtacgcg
ccggtggtggggctgaccaccccgacggtgcagggatcgttggtccggctgcgggcgacc
gaccagggcgcgaagtacaaccggatcctgttcgcgtcgccggccgatccggaacggcgg
cggtacctgacgatccggtccagcttcgacgagggaaggacctggcagaccgtggagcag
ggcacccggatcaccagcgactggtccggctactccgacatggcggtgctcggcaccggc
gagatcgggctgctgtacgagggcggcacggtcgacgcgcgggaccagatccggttcgcg
cggttcaccgagaccgacatcgggcacccggacggagcgagtgggccgaccacgccggac
gtgtcggggctcggcaaccacagctacctgcgcggcgggacgacggcggtcgcgggcagg
ttcgggcaggcgcgggacctggacggcaccgacgacgcgatccagctcccgtacgccgag
tcgctcgcgctcggatcgggcgacttcaccgcgatggcctggatccggtacggcgcgagt
accgcgagccaggcgatcttctggggctacgggatcaacgagttctcccagttctggttg
cgagccgagccggccagcagccggatccgggggctgatcaccgtcaacggcagcaccgcg
gcggtcgcctcgacgagggcctacaacgacaacgcctggcaccacgtcgctctgcaacga
aaggcgggcacgctgtcgctgtgggtcgacggagcgcaggtgggatcggtcgccgcgccc
agcgggtcgatcagtccgggccggccgttcaggatgtacgtcgggcagcggctcgacggc
ctgcaccggttcgacgggtcgctggacgaggtccggatctacaagcgggcgttgacggcg
gcggagatcgcgagcatccgcacctccaacgtcaccactgttccgaacgtcgtgctcgac
ctgccgctgggatag

DBGET integrated database retrieval system