KEGG   Kocuria flava: AS188_01315Help
Entry
AS188_01315       CDS       T04206                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kfv  Kocuria flava
Pathway
kfv00250  Alanine, aspartate and glutamate metabolism
kfv00410  beta-Alanine metabolism
kfv00640  Propanoate metabolism
kfv00650  Butanoate metabolism
kfv01100  Metabolic pathways
kfv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AS188_01315
   00650 Butanoate metabolism
    AS188_01315
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AS188_01315
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS188_01315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kfv01007]
    AS188_01315
Enzymes [BR:kfv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AS188_01315
Amino acid related enzymes [BR:kfv01007]
 Aminotransferase (transaminase)
  Class III
   AS188_01315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ALU38609
UniProt: A0A0U2YSV7
LinkDB All DBs
Position
complement(289535..290812)
Genome map
AA seq 425 aa AA seqDB search
MTSLSPVLKQATPVVVDHAQGSWIHGTDGRSYLDFTTGIGVTSTGHCHPKVVAAAREQVG
RIIHAQYTTVMHQPLLALTEKLGEVLPAGLDSVFYANSGSEAVEAAIRLARMATGRPNIV
VFQGGFHGRTVAAASLTTAGTKFSAGFAPLMAGVHMSAFPYAYRYGWDETTAVDFALREL
DYLLQTRTAPADTAAFLIEPALGDGGYLPTPGTFMDGLRERADRHGIQLIFDEVQAGVGR
TGKFWGHQYSSVSPDILVTAKGIASGFPISAIAASTETMSKAWPGSQGGTYGGNAVSAAA
GVATLEVVEEEGLVENSRVRGEQLKAGVEEIQERFPVIGDVRGRGLMLGIEFTAEDGSPD
ARTAAAVQQATTEQELLTLTCGPAGNVVRLIPPLVVTAEEIATGLERFEAAVAVVTEAVT
TATGS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacatctctcagccccgttctcaagcaggcgacccccgtggtcgtggaccacgcgcag
ggcagctggatccacggcaccgacggccggtcctacctcgacttcaccaccggcatcggc
gtgacgagcacggggcactgccacccgaaggtcgtggccgccgcccgggagcaggtgggc
aggatcatccacgcgcagtacaccaccgtcatgcaccagcccctgctggcgctgaccgag
aagctgggcgaggtgctgcccgcggggctggactccgtgttctacgcgaactccggctcc
gaggccgtcgaggccgcgatccgcctggcgcgcatggccaccggccggcccaacatcgtc
gtcttccagggcggcttccacggccgcaccgtcgccgccgcgtccctcaccacggccggc
acgaagttctccgccggcttcgcgcccctgatggccggcgtgcacatgtccgccttcccg
tacgcctaccgctacggctgggacgagaccaccgccgtggacttcgccctgcgggagctc
gactacctgctgcagacccgcaccgcgcccgccgacaccgcggcgttcctcatcgagccg
gccctcggtgacggcggctacctgcccacccccgggacgttcatggacgggctgcgcgag
cgcgccgaccgccacggcatccagctgatcttcgacgaggtccaggccggcgtggggcgc
accgggaagttctggggccaccagtactccagcgtctccccggacatcctcgtcacggcc
aagggcatcgcctccggcttccccatctcggccatcgcggcctccacggagaccatgtcc
aaggcgtggccgggctcccagggcggcacctacggcggcaacgccgtctccgccgccgcg
ggcgtggccaccctcgaggtcgtcgaggaggagggcctcgtggagaactcgcgcgtgcgc
ggcgagcagctgaaggctggggtcgaggagatccaggagcgcttcccggtgatcggcgac
gtccgcggccgcggcctgatgctgggcatcgagttcaccgccgaggacgggtccccggac
gcccggacggccgccgccgtccagcaggccaccacggagcaggagctgctgaccctgacc
tgcggccccgcgggcaacgtggtccggctcatcccgcccctggtggtcacggccgaggag
atcgccaccggcctggagcgcttcgaggccgccgtcgccgtcgtcaccgaggccgtcacc
accgccaccggatcctga

DBGET integrated database retrieval system