KEGG   Kocuria flava: AS188_01615Help
Entry
AS188_01615       CDS       T04206                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kfv  Kocuria flava
Pathway
kfv00620  Pyruvate metabolism
kfv00680  Methane metabolism
kfv01100  Metabolic pathways
kfv01120  Microbial metabolism in diverse environments
kfv01200  Carbon metabolism
Module
kfv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AS188_01615
  09102 Energy metabolism
   00680 Methane metabolism
    AS188_01615
Enzymes [BR:kfv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AS188_01615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ALU38661
UniProt: A0A0U3H723
LinkDB All DBs
Position
complement(346746..349520)
Genome map
AA seq 924 aa AA seqDB search
MTEHDRPVPHRIDAPLRADVRRITTLLGETLVRQRGPELLELVEQVRGLTKEAKASGDDD
AARRARELLGSLPLERATDLVRAFAHYFHLANAAEQVHRVRLLGARPEAQAWLAAAVADV
AGEAGPDGLRTAVERLDVRPVFTAHPTEASRRSVLTKIRHLSDLLAEDTAEGTAARRRQD
RRLAELVELLWQTDELRRSRPTPLDEARNALYYLREVLSGTVPGLLADLEDLLGEHEVAL
PAGPPLRFGSWIGGDRDGNPNVTPAITREVLRLQGQAAVDTALGFLELLVSRLSSSTAIV
AVEQELLDSVAEDVAHLPGLDARVLELNAQEPYRLKLTCIKAKLLNTRRRFAEETAHEPG
RDYRSTGQLLADLDVVARSLRAHAGERAAGGALAAAARTIAGSGLVLASLDVREHADAHH
EAVGQLLDRLGEHDRPYAQLDRAGRTRVLAAELAGRRPLAPPGLATGTVQLEGDADRTFA
VFREIGRAQAVYGEEAVETYIVSMTRGADDILAPVVLAREAGLVDLTGERPRAGLGFAPL
LETVHELRRSAEVIDELLSDPAYREVVRARGDLQEVMLGYSDSNKESGVMTSRWEIHRTE
RRLRDVAARHGVRLRLFHGRGGSVGRGGGPTHDAILAQPGGVLDGEIRFTEQGEVISDKY
SLPALARENLELSLAAVLRATALHQGPRSSEAELERWGQVMDVVSDAAFAAYRGLIEDPD
LPEYFVTATPVEQLGALNIGSRPSKRPSSDAGIEGLRAIPWVFGWTQSRQIVPGWFGVGS
GLRAAREAGMAQDLAAMLERWHFFASLVSNVEMTVAKTDLGIAAQYVSALVPERLHHVFD
TVRAEFALTCEELARLTGQAEPLDDNPVLQQTLAVRDQYLDPISHLQVELLRRLREAGGE
PDEQLQRAMLITINGIAAGLRNTG
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcacgaccgtcccgtcccccaccgcatcgacgccccgctgcgcgccgacgtc
cggcggatcaccacgctgctgggggagaccctggtgcgccagcgcgggcccgagctgctc
gagctcgtcgagcaggtgcgcgggctcaccaaggaggccaaggcctccggcgacgacgac
gccgcccgccgcgcccgcgagctgctgggctccctcccgctggagcgggcgaccgacctc
gtgcgggccttcgcccactacttccacctggccaacgcggccgagcaggtccaccgggtg
cggctgctcggcgcccgccccgaggcgcaggcgtggctggccgcggccgtggccgacgtc
gccggggaggccggcccggacgggctgcgcaccgccgtggagcgcctcgacgtgcgcccg
gtgttcaccgcccaccccaccgaggcctcccgccggtcggtgctcacgaagatccgccac
ctctccgacctgctggccgaggacaccgccgagggcaccgcggcccgccgccgccaggac
cggcgcctcgcggagctcgtcgagctgctgtggcagaccgacgagctgcgccggtcccgg
cccaccccgctcgacgaggcccgcaacgccctgtactacctgcgggaggtgctctccggg
acggtgccggggctgctggccgacctcgaggacctgctcggggagcacgaggtggccctg
cccgcgggaccgccgctgcgcttcggctcctggatcggcggcgaccgcgacggcaacccc
aacgtcaccccggccatcacccgcgaggtgctccgcctgcagggccaggccgccgtcgac
accgccctgggcttcctcgagctgctcgtctcccggctgtcctcctcgaccgcgatcgtg
gccgtggagcaggagctgctggactccgtggccgaggacgttgcccacctgccgggcctg
gacgcccgcgtgctcgagctcaacgcccaggagccctaccggctcaagctcacctgcatc
aaggccaagctgctcaacacccgccgccgcttcgcggaggagaccgcccacgagcccggc
cgcgactaccgcagcaccgggcagctgctcgccgacctcgacgtggtcgcccggtccctg
cgcgcgcacgcgggcgagcgggcggccggcggggcgctcgcggcggccgcgcgcacgatc
gccggatcggggctggtcctggcctccctcgacgtgcgcgagcacgccgacgcccaccac
gaggccgtcgggcagctgctggaccgcctcggcgagcacgaccggccctacgcgcagctg
gaccgcgccggccgcacccgggtgctggccgccgagctggccgggcgccggccgctggcc
ccgccgggactggccaccgggacggtgcagctcgagggggacgcggaccgcaccttcgcc
gtcttccgcgagatcggccgggcccaggcggtctacggcgaggaggccgtggagacctac
atcgtgtcgatgacccgcggcgcggacgacatcctcgcccccgtggtcctcgcccgcgag
gccgggctcgtggacctcacgggggagcggccccgggcgggcctgggcttcgccccgctg
ctggagaccgtccacgagctgcgccgctcggccgaggtgatcgacgagctgctctccgac
cccgcctaccgtgaggtcgtgcgcgcccgcggggacctgcaggaggtcatgctcggctac
tccgactccaacaaggagtccggggtgatgaccagccggtgggagatccaccgcaccgag
cgccggctgcgcgacgtcgccgcccggcacggggtgcggctgcggctcttccacggccgc
ggcgggtccgtgggccgcggcggcggccccacccacgacgcgatcctcgcccagcccggc
ggagtgctcgacggtgagatccgcttcaccgagcagggcgaggtgatcagcgacaagtac
tccctgccggccctggcccgggagaacctcgagctgtccctggccgccgtgctgcgcgcg
accgccctgcaccagggcccgcgctcctccgaggccgagctcgagcggtgggggcaggtg
atggacgtggtcagcgacgccgccttcgccgcctaccgcgggctgatcgaggaccccgac
ctgcccgagtacttcgtgaccgcgacccccgtggagcagctgggggcgctgaacatcggt
tcccggccctcgaagcgcccgtcgtcggacgcggggatcgaggggctgcgcgccatcccg
tgggtcttcggctggacccagtcgcgccagatcgtccccggctggttcggcgtgggctcc
gggctgcgcgccgcccgggaggccgggatggcacaggacctcgcggcgatgctcgagcgc
tggcacttcttcgcctcactggtctccaacgtggagatgaccgtggccaagacggacctc
gggatcgccgcccagtacgtctccgcgctcgtgcccgagcggctgcaccacgtcttcgac
accgtccgggcggagttcgccctgacctgcgaggagctcgcccggctcaccggccaggcc
gagccgctggacgacaacccggtcctgcagcagaccctcgcggtgcgcgaccagtacctc
gacccgatctcccacctgcaggtcgagctgctgcgccggctccgggaggccggcggcgag
ccggacgagcagctgcagcgggcgatgctcatcaccatcaacggcatcgccgcgggcctg
cgcaacaccggctga

DBGET integrated database retrieval system