KEGG   Kocuria flava: AS188_11245Help
Entry
AS188_11245       CDS       T04206                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kfv  Kocuria flava
Pathway
kfv00564  Glycerophospholipid metabolism
kfv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kfv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AS188_11245
Enzymes [BR:kfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AS188_11245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: ALU40230
UniProt: A0A0U3HRU6
LinkDB All DBs
Position
complement(2518258..2520006)
Genome map
AA seq 582 aa AA seqDB search
MAHPTLSATDRARALDAMSGGPELDVLVVGGGITGAGIALDAATRGLRTGIVEAQDWAGG
TSQWSSKLVHGGLRYLQQLDFKLVAEALRERELLLDFLAPHLVKPVPFLYPLTHRWWERP
YVAAGIGLYDALAHLGAKVATLPYQRHLTAAGVARVFPDVKPGSMVGAVQYWDARVDDAR
LVLTIVRTAVRHGALAANRARAVDFPRDAGGRVTGAVVRDLETGRERTVRARTVIAATGV
WTERIQDRAQAEGGLKVLASKGIHIVVPRERIRSDTGLILQTEKSVLFIIPWERYWLIGT
TDTPYEQELENPVATSADIDYVLEHANVVLDEPLGRGDVIGVYAGLRPLLQPGTKGGGEP
AQSTKISREHTVTEVVPGLITIAGGKLTTYRVMAEDAVDLALGAGRAKELPSVTDRTALL
GADGYLALRRRAGTLGSAHGWDEEQVLHLLRRYGSAVEEILELVEQRPDLGRPLGGAAPY
LRAEIVHACTHEGALHLEDVFDTRTRLTWERPRHGLDALDEIAELAAGALGWDADRRAAE
VEAYRLRCAAEDAAAAAPDDAAAAAARAAAPDVLELVRRDAG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccccaccctctccgccaccgaccgcgcccgcgcgctcgacgcgatgagcgga
ggacccgagctcgacgtcctcgtcgtcggcggcggcatcaccggcgccggcatcgccctc
gacgccgccacccgcggcctgcgcaccggcatcgtcgaggcccaggactgggccggcggc
acctcccagtggtcctccaagctcgtccacggcggcctgcgctacctccagcagctcgac
ttcaagctcgtcgccgaggccctgcgcgagcgcgagctgctcctggacttcctcgccccg
cacctggtcaagcccgtccccttcctctaccccctgacccaccgctggtgggagcggccc
tacgtcgccgccggcatcggcctctacgacgccctggcccacctgggcgccaaggtcgcc
accctgccctaccagcgccacctcaccgccgccggcgtcgcccgcgtcttccccgacgtc
aagcccggctccatggtcggcgccgtccagtactgggacgcccgcgtcgacgacgcccgc
ctcgtgctcaccatcgtgcgcaccgccgtgcgccacggcgcgctcgcggccaaccgggcc
cgggccgtggacttcccgcgcgacgccggggggcgggtcaccggcgcggtcgtgcgcgac
ctcgagaccggccgggagcgcaccgtgcgcgcccgcaccgtgatcgcggcgaccggggtg
tggaccgagcggatccaggaccgcgcccaggccgagggcgggctgaaggtgctcgcgtcc
aagggcatccacatcgtggtgccgcgcgagcggatccgcagcgacaccgggctgatcctg
cagaccgagaagtccgtgctgttcatcatcccgtgggagcggtactggctgatcggcacc
accgacaccccctacgagcaggagctcgagaacccggtggccacctccgcggacatcgac
tacgtgctcgagcacgccaacgtggtcctcgacgagcccctggggcgcggggacgtcatc
ggcgtctacgccgggctgcgcccgctgctgcagccggggaccaagggcgggggcgagccg
gcccagtccacgaagatctcccgggagcacaccgtcaccgaggtcgtcccggggctgatc
accatcgccggcggcaagctgaccacctaccgggtgatggccgaggacgccgtcgacctc
gccctcggggccggtcgggcgaaggagctgccctcggtcaccgaccgcaccgccctgctc
ggcgccgacggctacctcgccctgcgccgtcgcgccggcaccctcgggagcgcccacggc
tgggacgaggagcaggtgctgcacctgctgcgccgctacggctcggccgtcgaggagatc
ctcgagctcgtcgagcagcgccccgacctcggccgcccgctcggcggcgccgcaccctac
ctgcgcgccgagatcgtccacgcctgcacccacgagggcgccctgcacctcgaggacgtc
ttcgacacccgcacccgcctcacctgggagcggccgcggcacggcctcgacgccctcgac
gagatcgccgagctcgccgccggggccctgggctgggacgcggaccggcgcgccgccgag
gtcgaggcctaccggctgcgctgcgccgcggaggacgcggccgccgccgcccccgacgac
gccgcggccgccgccgcccgggccgccgccccggacgtgctcgagctcgtccgccgggac
gccggctga

DBGET integrated database retrieval system