KEGG   Kangiella geojedonensis: TQ33_0295Help
Entry
TQ33_0295         CDS       T03889                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kge  Kangiella geojedonensis
Brite
KEGG Orthology (KO) [BR:kge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TQ33_0295
Enzymes [BR:kge01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TQ33_0295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like DAO FAD_binding_2 Thi4 FAD_oxidored NAD_binding_8 Lycopene_cycl AlaDh_PNT_C NAD_binding_7 FAD_binding_3 Glutaredoxin Thioredoxin_9 K_oxygenase Thioredoxin_4 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AKE51283
UniProt: A0A0F6RB53
LinkDB All DBs
Position
complement(303183..304796)
Genome map
AA seq 537 aa AA seqDB search
MLNTQILEALKSYTAEMQKTVTFVLQNGEHSKREELKDFLEQFASVSDRINVEERSVNLL
RSPISFLLEVDGVDSGIQFSGIPSGHEFNSLVLAVLQSAGTPVKLDSSLQSMVKNIDQDM
KFEVFVSLSCHNCPDVVQALNQFAVLNPNISAEMIDGGLFQNVIEERDIQGVPSVYLNGE
LFANGKVTAAELIDKLLAFDPSIAKADANEKLPLQDVVVIGGGPAGVSSAIYSARKGLKV
TLIADRIGGQVKDTMGIENLISVPKTTGPELSGALQAHLNEYDVTVKEHLRVTEVSQGDI
KNITLSSGEVIDTKTMIIATGAKWRELGIPGEKENVGNGVAYCPHCDGPFFKGKDVAVIG
GGNSGIEAALDLAGIVKSVTVFEFMPDLKADKVLVDQAESKDNITILKNVATKEIHATDG
KVSSIEYTDRATETNHSIELEGVFVQIGLVPNSHFLGDVVETTKFGEIVINEKCETSQPG
IYAAGDVTTVPYKQIVVSMGEGSKASLASFEYLLANSSKLKKMYEDHQSSQDERNAA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatacacaaattctagaagctttgaaaagctataccgccgagatgcaaaagacg
gtgactttcgtcttgcaaaacggtgaacattcaaagcgcgaggaactgaaagacttttta
gagcagtttgctagcgttagtgatcgtattaatgttgaagaacgctctgtaaacttatta
cgtagtcccattagctttttactggaagtcgatggcgtagacagcggcatccagttctca
ggaatcccttcaggacacgagtttaactccttagtgcttgcagtgcttcaatctgcagga
acaccggtaaaattagatagctcactacaaagcatggtcaaaaatattgaccaagacatg
aaattcgaagtgtttgtgagcttaagctgtcacaactgtccagacgtggttcaagcgtta
aaccaatttgccgtgttaaacccaaacatttcagcagagatgattgacggtggcttattc
caaaacgtcattgaagagcgcgatattcagggcgtacccagcgtttacctaaacggtgag
ttatttgccaacggtaaagtgactgcggcagaacttatcgataagttattagcgtttgat
ccatcaatcgctaaagccgacgctaatgaaaagctacctctgcaagatgtcgtcgttatc
ggcggtggcccagcgggcgtcagttcagctatttacagcgctcgtaaaggcttaaaagtg
acgttaattgccgaccgcatcggcggccaagttaaagacaccatgggtattgaaaactta
atctctgtgccaaaaaccacaggtcctgaattatcaggtgcgttacaagcacacttaaac
gagtatgatgttacggtcaaagaacatttgcgcgtgacagaagtgagccaaggcgatatc
aaaaatatcaccttgtcatctggcgaagttattgatactaaaaccatgattatcgccaca
ggcgctaaatggagagaactgggtattccaggtgaaaaagaaaacgtcggtaatggtgtg
gcttactgcccgcactgcgatggcccattctttaaaggtaaagatgttgccgtcatcggt
ggcggtaactctggtatcgaggcggcgttggatctagcaggtatcgtgaaatctgtaacc
gtcttcgagtttatgcccgacttaaaagccgacaaagtattggtcgaccaagccgaatca
aaagacaatatcacgattctaaaaaacgttgctaccaaagaaatacacgctactgatgga
aaagtatcctctatcgagtataccgatagagcaaccgaaacaaaccacagtattgaatta
gaaggtgtctttgtacaaattggcctagtgcctaacagtcacttcctcggcgatgtggtc
gaaaccacaaagttcggtgaaatcgtcattaacgaaaaatgcgaaacctcgcaaccgggt
atttatgctgccggtgatgtcaccacggtgccgtataaacaaatcgtcgtatctatgggc
gaaggctctaaagcatcactggcatccttcgagtatctactggctaactccagcaaactc
aaaaagatgtacgaggatcatcaatcttctcaggacgaacgtaacgccgcatag

DBGET integrated database retrieval system