KEGG   Kangiella geojedonensis: TQ33_1236
Entry
TQ33_1236         CDS       T03889                                 

Definition
(GenBank) LOG family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
kge  Kangiella geojedonensis
Pathway
kge00230  Purine metabolism
kge00240  Pyrimidine metabolism
kge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TQ33_1236
   00240 Pyrimidine metabolism
    TQ33_1236
Enzymes [BR:kge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     TQ33_1236
    3.2.2.-  
     TQ33_1236
SSDB
Motif
Pfam: DUF3412 Lysine_decarbox DUF4478 LDcluster4 Tox-REase-9
Other DBs
NCBI-ProteinID: AKE52194
UniProt: A0A0F6TR28
LinkDB
Position
1403031..1404419
AA seq 462 aa
MKHIDIEITAESGLELLTNDEIARLSEHSKDGDHELFKKCVLAVLNSTQVTDEISYHKEQ
LKNFDVDVVPLNKGVKLKIKNAPTTALVDGFMIQGLKEQVFSVLRDIVFLKQELESNSRI
DFNSSNGCTNAIFHILRNAKALRSGTDPNMVVCWGGHAIPEFEYQYTKEVGYRLGLRGFD
IITGCGIGAMKGPMKGALIGHSKQRINNARYVGITEPGIIAAESPNPIVNELIVMPDIEK
RLEAFVRLGHGFVVFPGGVGTAEEILYILGILLHPDNADTPFPLIFTGPKESAAYFEHID
RFIGDTLGQKAQSKYQIIIDDPVSVARAIQKGIAEVRQYRKEVHDAYHFNWQLEILWDFQ
EEFIPTHENMSKLNLSADQPLHLLAANLRKAFSGIVSGNVKEQGIQEVSKHGPYQITGDT
HIMDQLDALLESFVTQKRMKLNAENYVPCYRVNSASMASKTS
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgaagcatatagatattgaaattactgccgagtcaggcctagaacttcttaccaacgat
gagattgcccggcttagtgagcactctaaagacggagaccatgaattatttaagaagtgt
gtgttagccgttttaaacagcacacaagttaccgatgaaattagctatcacaaagaacag
ttaaagaacttcgacgtggacgttgtccctcttaataaaggcgttaaactcaaaataaag
aatgctccgacgacagctttagttgatgggtttatgatccaagggctgaaagaacaagta
ttcagcgttttgcgtgatattgtgttcctaaagcaagaactagagtcaaactctagaata
gactttaattcgagcaatggctgtactaacgctatatttcatatcttaaggaatgccaaa
gctttgcgctcaggtacggatcctaatatggtcgtttgctggggtgggcacgccattcct
gagtttgaatatcaatatactaaagaagtcggctatcgattaggccttagaggctttgat
ataattacaggttgcggcattggggccatgaaaggccccatgaaaggcgctttaattggt
cactccaagcaacgcattaataatgcccgctatgttggtattaccgaaccaggaattatt
gcagcagaatctcccaacccgatcgttaatgagctaattgtcatgcctgatatcgaaaag
cgattagaggcatttgttagactaggtcatggattcgttgtttttcctggtggggtggga
acagctgaagagattttatatatccttggtatcttattacatcctgataacgcagatacc
cccttccctttaatttttacagggcctaaagagagcgctgcatactttgagcatatcgat
aggtttattggagacactcttggtcaaaaggcacaatcaaaatatcaaatcatcattgat
gatccggtgtctgttgcaagagcgatccaaaaaggcatcgctgaagttagacaatataga
aaagaggtgcatgatgcttaccactttaattggcagctagaaattctatgggacttccaa
gaagaatttataccaactcatgagaatatgagcaaactcaatctaagtgctgatcaaccg
ctgcaccttttggcagcaaacttgcgaaaagcattctcaggaatagtatctgggaatgtc
aaagaacagggtattcaagaagtgagtaagcatggtccttaccaaattaccggtgatacc
cacattatggatcagcttgatgcgttacttgaatcatttgttactcagaaacgcatgaag
ctgaatgctgaaaactatgtgccctgttatcgcgttaactcagcttcgatggctagtaaa
acatcataa

DBGET integrated database retrieval system