KEGG   Kangiella geojedonensis: TQ33_1599Help
Entry
TQ33_1599         CDS       T03889                                 

Definition
(GenBank) Glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kge  Kangiella geojedonensis
Pathway
kge00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kge00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TQ33_1599
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kge02000]
    TQ33_1599
Enzymes [BR:kge01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TQ33_1599
Transporters [BR:kge02000]
 Other Transporters
  Pores ion channels [TC:1]
   TQ33_1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: AKE52544
UniProt: A0A0F6TRM1
LinkDB All DBs
Position
complement(1789030..1789671)
Genome map
AA seq 213 aa AA seqDB search
MPLSQSTDCNTIFYTNPQSRGQIARWMLEEVGADYRQEILEYGAGMKSQEFLKINPMGKV
PTIVHGGKVITECAAICAYLADAFPEKGLAPSLDNRADYYRWLFFSAGPLEAAIVNRSLG
VEVKADQERMVGYGNYELVLDTLSQQLLDSPYVAGEHFTAADVYVGSHVLWGLHFGSMDM
RPGFEEYAARVSERQAYKAAKLIDEELIAEREK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccgttatctcagtccactgattgcaacactattttttacaccaacccacagtcacga
ggtcaaattgctcgttggatgttggaagaagttggcgcagactatcgtcaggaaatactg
gagtatggcgctgggatgaaatcccaagagttcctcaaaatcaatcccatgggaaaggtt
ccgaccattgtccatggcggtaaagtcattactgagtgtgcagcgatttgtgcttacctc
gctgatgcttttcctgaaaaaggtctagcgccgagtcttgataatcgcgcagattattac
cgctggctgttttttagtgcggggccactcgaagcggctatcgtcaaccgttccctagga
gtcgaggttaaagctgatcaggaaagaatggtgggttacggtaattacgagttggttcta
gatactttgtcacagcaattgttagattcgccctatgttgctggcgaacatttcactgca
gctgacgtctatgtgggttcgcacgttttatggggcttgcattttggcagtatggacatg
cggcctggttttgaagaatatgccgcgcgtgtttctgagcgacaagcgtataaagccgct
aaactgatagatgaagaattgatagctgaaagagaaaagtag

DBGET integrated database retrieval system