KEGG   Kangiella geojedonensis: TQ33_1989Help
Entry
TQ33_1989         CDS       T03889                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
kge  Kangiella geojedonensis
Pathway
kge00380  Tryptophan metabolism
kge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    TQ33_1989
Enzymes [BR:kge01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     TQ33_1989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKE52920
UniProt: A0A0F6TRT4
LinkDB All DBs
Position
2193920..2195209
Genome map
AA seq 429 aa AA seqDB search
MSNLFSLEHAQQLDSQDPLKHIRDEFHIPKQDNGDEEIYLCGNSLGLQPRLAAEYVNDEL
SQWQKLGVKGHFSGDYPWMPYHEFLSEGFADLVGAKIKEVVSMNTLTANLHFMMVSFYRP
TTQRHKIIIEDHAFPSDHYAVESQIKYHGFDPEQSMVLLKPRDGEETLRDDDILAAIKEH
GESTALIMLPGVQYYTGQVLDMKSITEAGHAQGCNVGFDLAHAAGNIPMQLHDWGVDFAA
WCTYKYLNSGPGSVAGCFVHERHHSNKDLPRFAGWWGHDKDSRFKMENHFVPMESAEAWQ
LSNPPILSLAAIRGSLDTIKKAGGIHQLRHKSLKLTSYLRQLLEQELPQTINILTPEDTK
ASGAQLSLTVNLDGADGKQIFDAIEKAGVTCDFRHPNVIRVAPAPQYNSFEDCYRFVSIL
KKSIEGAVS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttattttccttagaacacgcacaacaactcgattcacaagatcctttaaag
catattcgcgacgagtttcacatccccaaacaagacaatggcgatgaagaaatttatctt
tgcggaaactctttagggttacaaccaaggttggccgccgaatacgtgaatgatgagtta
tcacaatggcaaaagctcggtgttaagggtcacttttcaggtgattatccttggatgccc
tatcatgagtttttgagtgaaggttttgccgatttggtgggcgcaaagattaaagaagtc
gttagcatgaatacactaaccgctaaccttcattttatgatggtcagtttttaccgtcca
accactcaacgtcataaaatcattattgaagatcacgcctttccttccgatcattatgcg
gttgaatcacaaattaaatatcatggatttgatcccgagcaaagcatggttttattaaag
cctcgcgacggtgaagaaactttgcgcgacgatgatattttggctgccattaaagagcat
ggcgaaagcacagccctgattatgctgcctggcgttcagtactacaccgggcaagtcctc
gacatgaaaagtatcactgaagccggccacgcccaaggttgtaacgttggttttgaccta
gctcatgccgcaggtaacattccaatgcagcttcatgactggggcgtcgatttcgctgct
tggtgcacctataaatatttgaattcagggccaggctcagtcgctggttgctttgttcat
gaacgccatcatagcaacaaagatctgcctcggtttgcaggttggtggggccatgacaaa
gactctcgctttaagatggagaatcattttgttccaatggaaagcgctgaagcatggcag
ttatcaaacccaccaatcttgtctttagcagcgatacgtggctcgcttgataccataaaa
aaagctggcggcattcatcagttacgtcataaatcgctcaaactaaccagctatttacgc
cagttacttgagcaagaacttccgcaaaccattaacatcttgacaccagaagacactaag
gcgtcaggtgcgcagttgtccctaacggttaatctggatggcgctgatggtaagcagata
tttgatgccattgaaaaagcaggggttacctgcgacttccgtcatccaaacgttattcgt
gttgctccagcgccacagtacaattcgtttgaggattgctatcgctttgtgagtatcctc
aagaagtcgattgaaggagctgtttcatga

DBGET integrated database retrieval system