KEGG   Kluyvera georgiana: CEW81_19210Help
Entry
CEW81_19210       CDS       T04930                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kgo  Kluyvera georgiana
Pathway
kgo00730  Thiamine metabolism
kgo00790  Folate biosynthesis
kgo01100  Metabolic pathways
kgo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kgo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CEW81_19210
   00790 Folate biosynthesis
    CEW81_19210
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CEW81_19210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kgo04147]
    CEW81_19210
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kgo00537]
    CEW81_19210
Enzymes [BR:kgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CEW81_19210
Exosome [BR:kgo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CEW81_19210
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kgo00537]
 Enzymes
  CEW81_19210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme PT-VENN Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: ASG64008
UniProt: A0A248KK00
LinkDB All DBs
Position
complement(3807651..3809060)
Genome map
AA seq 469 aa AA seqDB search
MKYRAIVAALLPLLGLPTVHAETSTAVLDNRAAQGDITQPGGARRLSADQTDAIRASLNN
KQAKNVILLIGDGMGDSEITAARNYAEGAGGYFKGIDALPLTGQYTHYALNKKTGKPDYV
TDSAASATAWSTGVKTYNGALGVDIHEKDHQTILELAKAAGLATGNVSTAELQDATPAAQ
ISHVTSRKCYGPSVTSEKCPTNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGE
WQGKTLREQAQARGYQLVDNATTLAAITQANQDKPLLGLFSDGNMPVRWEGPKASYHGNL
DKPAVTCTPNPKRDASVPTLAQMTDKAISLLSANEKGFFLQVEGASIDKQDHAANPCGQI
GETVDLDEAVQKALEFAKKDGNTLVIVTADHAHASQIIPPETKAPGLTQALNTKDGSVMV
MSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLYYTMKAALGL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgaaataccgtgctatcgttgccgcattattacctctgctgggtctgcctaccgttcac
gcggagacctctaccgctgttctcgataaccgcgccgcgcaaggggatatcacccagcca
ggcggtgctcgccgtttatctgccgatcaaaccgatgcgattcgcgcctccttaaataat
aaacaggccaaaaacgttattttgctgattggcgatgggatgggcgactctgaaattacc
gccgcgcgtaactacgcggaaggcgcgggcggttattttaaaggtattgacgcgctgccg
ttaaccggccagtacacccattatgcgctgaacaaaaagaccggtaagccggactacgtg
actgactccgccgcgtcggccaccgcatggagtaccggcgtgaaaacctataacggcgcg
ctgggcgtcgatatccatgaaaaagatcaccagacgattcttgagctggcgaaagcggcc
ggcctggcgaccggtaacgtgtctaccgccgaattgcaggatgcgacccctgcggcgcag
atttctcatgtcacttcgcgtaagtgttacggcccgagcgtgaccagcgaaaaatgccca
accaacgcgctggaaaaaggcggtaaagggtccattaccgaacagctgctgaatgcccgc
gcagacgtgacgctgggcggcggcgcaaaaaccttcgccgaaactgcgacagcgggtgaa
tggcagggtaaaaccctgcgtgagcaggcgcaggcgcgcggctatcagctagtggataac
gccaccacgctggcggcgattactcaggctaaccaggacaaaccgttgctggggctgttc
tctgacggcaatatgccggttcgttgggaagggccgaaggcctcttatcatggcaacctg
gataagccagcggtgacctgtacgccgaacccgaaacgtgatgccagcgtgccgactctg
gcgcagatgaccgacaaagccatctccctgttgagcgccaacgaaaaaggctttttcctg
caggttgaaggggcgtcgatcgataaacaggatcacgcggcgaatccgtgcggccagatt
ggcgaaacggtcgatctggatgaagcggtacaaaaagcgctggaatttgcgaaaaaagac
ggcaataccctggtgatcgttaccgctgaccacgcgcacgccagccagattattccaccg
gaaaccaaagcgccgggcctgacgcaggcgttgaataccaaagatgggtcagtgatggtg
atgagctacggtaactcggaagaggagtcaatggagcatactggcacccagctgcgtatc
gctgcctacggcccgcatgccgctaacgtagtgggcctgaccgaccagactgatctctac
tacaccatgaaagccgcgttggggctgtaa

DBGET integrated database retrieval system