KEGG   Kerstersia gyiorum: EHF36_00935Help
Entry
EHF36_00935       CDS       T05924                                 

Definition
(GenBank) RNB domain-containing ribonuclease
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
kgy  Kerstersia gyiorum
Brite
KEGG Orthology (KO) [BR:kgy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kgy03016]
    EHF36_00935
Enzymes [BR:kgy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     EHF36_00935
Transfer RNA biogenesis [BR:kgy03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    EHF36_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: QBR39354
LinkDB All DBs
Position
complement(227415..229307)
Genome map
AA seq 630 aa AA seqDB search
MYLFYEEDGGFKIGHILAETDASLQVESESGKRSKIKRTSALFTFDTKDASNFLTQAQAQ
AEDIDLDFLWECSSQEDFEAAEFAADYYGHAPSALEKAALILRLHSAPIYFHRRGKGRYR
AAPADILAAAKAAQEKKRLQAEQQQQWVDEMTAGRLPAPIAEAAEMLLIRPDKNSMAWKA
MDAACQQLQKSPERLLLDLGAWPSPLALHKARFLAANFPRGTGFGDITVPDLGADLPLAD
AQAYSIDDITTTEIDDALSVQRLDDGWLRVGVHVAVPGLAVTRDSELDKHARTRLSTVYT
PGEKIPMQPEVLISRFSLDAGKPVPALSLYVEAYPATGEIRHTETRLERVQVRENLRHNQ
MDAIYSEEALAGPADAHPHLDWMQPLWQLALSLSARRDEVRGKPENNNRVEYSFYLDGNP
DDPDATVRIEPRRRNAPLDRLVAEYMILANTLWGELLARTGLPGIYRSQQAGRTRMSTHA
LPHEAIGVPQYAWCTSPLRRYVDLVNQWQLIAAAQHGISAPLVAPFKPRDADLFAIIGAF
EAQYATWHDHQDAMERYWCLRWFQQQGLKEVTAHVLREDLVRFACAPFVTRVAGMPELER
GTPVRLELMGCDELALTLDCRYLGVIAENE
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtatctgttctacgaagaagacggcggtttcaagatcggccatatccttgctgaaacc
gacgccagcctgcaagtggagtcggaaagcggcaagcgcagcaaaatcaagcgcaccagt
gcgctctttacctttgataccaaggacgcttccaatttcctgacgcaagcccaggcccag
gccgaagacatcgacctcgatttcctttgggaatgcagcagccaggaagatttcgaggct
gccgagtttgcggccgattactacggccatgccccttccgcgctggaaaaagctgccctg
atcctgcgcctgcacagcgcccccatctatttccaccgccgtggcaaaggacgctaccgc
gccgcgccggcagacattcttgcggccgccaaggcagcccaggagaaaaagcgcctgcag
gccgaacagcagcagcaatgggtcgatgaaatgacggcaggccgcctgcctgcccccatt
gccgaagccgccgaaatgctgctgatccgccccgacaagaacagcatggcctggaaggcc
atggacgccgcctgccagcaactgcagaaaagccccgagcgcctgctgctggacctgggc
gcctggcccagcccgctggcgctgcacaaggcccgcttcctggccgcgaactttccgcgt
ggcaccggctttggcgacatcacggtgcctgacctgggcgcggacctgccgctggccgac
gcccaagcctattccatcgacgacatcaccaccactgaaatcgacgatgcgctgtcggtg
cagcgtctggatgatggctggctgcgcgtaggtgtccacgtggccgtaccgggcctggct
gtcacccgcgacagcgaactggacaaacatgcgcgcacccggctgtccacggtttatacg
cctggggaaaaaattcccatgcagcccgaggtgctgatcagccgcttctcgctggatgcc
ggcaaacccgtgcccgcgctgtcgctgtatgtggaagcctatcctgccaccggcgaaata
cgccacactgaaactcgcctggagcgtgtgcaggtgcgcgaaaacctgcgccacaaccag
atggatgccatctacagcgaggaagccctggccggccccgccgatgcccacccgcatctc
gactggatgcagccgctctggcaattggcgctgtccttgtccgcccgccgcgatgaagtg
cgcggcaagccggaaaacaataaccgggtcgaatacagcttctatctggatggcaacccg
gacgaccccgacgccaccgttcgcatcgagccgcgccgccgcaatgccccgctggaccgg
ctggtggccgaatacatgatcctggccaatacgctctggggcgaattgctggcccgcacc
ggtctgcctggcatctatcgctcgcagcaggcgggccgtacccgcatgagcactcacgcc
ctgccgcacgaggccatcggcgtgccgcaatacgcctggtgcacgtcgccgctacggcgt
tatgtcgatctggtcaaccagtggcaactgatcgccgctgcccaacatggcatctcggcg
ccgctggtggcgcccttcaagccacgcgacgccgacctgttcgcgatcatcggcgccttc
gaggcgcaatacgcaacctggcacgaccaccaggatgccatggagcgctactggtgcctg
cgctggttccagcagcagggcctgaaggaagtgacggcgcacgtcctgcgcgaggatctc
gtgcgcttcgcctgcgccccctttgtcacccgcgtggccggcatgccggagctggaacgc
ggcacgccggtcaggctggaattgatgggctgtgacgaactcgcgctgacactggactgc
cgctacctgggcgtcatcgccgaaaacgagtaa

DBGET integrated database retrieval system