KEGG   Kerstersia gyiorum: EHF36_07245Help
Entry
EHF36_07245       CDS       T05924                                 

Definition
(GenBank) helix-turn-helix domain-containing protein
Organism
kgy  Kerstersia gyiorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: QBR40447
LinkDB All DBs
Position
complement(1640434..1641402)
Genome map
AA seq 322 aa AA seqDB search
MQPTAAHPVSQISTNTLPPSQRLDYWESYNASMLVGLKCSAFSDDGLLATQRNLMMGDIR
LAEIQANEHVIERTPQMVRRHPKDSVFASLILESNAFFYQGSSCTQLEPGDLILYDTRHA
YLFGFTGSMRQFLLDTPADWFYQSCSHSSLTRPLHVPGGSGPGRVLNAALRRLAAGTFAE
PASTSADQMHQQAGELLRSLLAGDTGNSSALRATYLQAARSHIDSQLDDHTLDAERVAGA
AGITLRHLNRLLEPEGRTVSQLILERRLDRAASLLRRRDMQRYSIAEISWRCGFSSPAHF
ARTFRARHALTPTQMREAALSG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaactgccgcccaccccgtcagccagatatcaaccaataccctgccgcccagc
cagaggctggactattgggagtcctataacgcctccatgctggtcggcctgaaatgttcg
gccttttcggatgatggcctgctggccacccagcgcaacctgatgatgggcgacatccgt
ctggcggaaatccaggccaatgaacacgtgatcgagcgcacgccgcagatggtgcgccgc
catcccaaggattcggtcttcgcttcgctgatcctggagagcaacgcctttttctaccag
ggcagcagctgcacgcaactggaaccgggcgacctgatcctgtacgacacacgccatgcc
tacctgttcggcttcaccggcagcatgcgccagttcctgctggatacgcccgcagactgg
ttctatcagtcctgtagccactccagcctcacacggccgctgcacgtcccgggcggcagc
gggcccggacgcgtgctcaatgcggcgctgcgccgcctggccgccggcaccttcgccgag
cctgccagcaccagtgcagaccagatgcaccagcaggccggagaactgctgcgcagcctg
ctggctggcgacaccggcaacagcagcgcgctgcgcgccacctatctgcaggcggcgcgc
agccatatcgacagccagttggacgatcacaccctggatgcggaacgggtggcgggggcg
gccggcatcacgctgcgccacctgaaccggctgctggaaccggaaggacgcaccgtatcg
caattgatcctggaacggcgcctggaccgcgccgccagcctgctgcgacgccgcgacatg
caacgctacagcatcgcggaaatttcctggcgctgcggcttctccagcccggcgcatttc
gcccgcaccttccgcgcacgccacgcactcacgcccacgcaaatgcgcgaggccgcactg
tccggttag

DBGET integrated database retrieval system