KEGG   Kerstersia gyiorum: EHF36_07250Help
Entry
EHF36_07250       CDS       T05924                                 

Definition
(GenBank) cupin domain-containing protein
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
kgy  Kerstersia gyiorum
Pathway
kgy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kgy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    EHF36_07250
Enzymes [BR:kgy01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     EHF36_07250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: QBR40448
LinkDB All DBs
Position
1641666..1642199
Genome map
AA seq 177 aa AA seqDB search
MPELPSNEFWRGLKPIPNCFQPDAKPEVYISNAPTEDERMYVPFTDTVSSRPLWISPSEN
RWCDILMAKEAGLVNRHYHPHEVFAYTISGKWGYLEHDWTAHAGDFVYETPGEGHTLVAY
EHEDPMRAFFIVKGPLIWLDENGEPEGYFDVHSYIDMCRKHYDKVGIGADYVDTLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgccttccaatgaattctggcgcggcctcaagcccattcccaactgtttt
cagccggatgccaagcccgaggtctatatctcgaacgcccccaccgaagacgagcgcatg
tacgtgccgttcacggataccgtctcctcccgcccgctgtggatttccccgtcggaaaat
cgctggtgcgacatcctgatggccaaggaagctggcctggtgaaccgtcactatcatccg
cacgaggtgttcgcctacacgatctcgggcaagtggggctatctggagcatgactggacg
gcgcatgccggcgattttgtctacgaaacgccgggcgagggccatacgctggtcgcctat
gagcatgaagaccccatgcgcgcctttttcatcgttaaggggccgctgatctggctggac
gagaacggcgagccggaaggctatttcgatgtacacagctacatcgacatgtgccgcaag
cattacgacaaggtcggcataggcgccgattacgtcgataccctgttccgctag

DBGET integrated database retrieval system