KEGG   Kerstersia gyiorum: EHF36_07255Help
Entry
EHF36_07255       CDS       T05924                                 

Definition
(GenBank) MFS transporter
Organism
kgy  Kerstersia gyiorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_2 Nuc_H_symport MFS_1_like TRI12 LacY_symp
Motif
Other DBs
NCBI-ProteinID: QBR40449
LinkDB All DBs
Position
1642312..1643586
Genome map
AA seq 424 aa AA seqDB search
MRLFKEASYENRLLAVLFLAFGFVFFDRLALSYLFPFVSAELGLSNTELGMLSSVLALAW
AVSGAFMGAYTDRRGRRKTILIVSVVLFSVFSALSGLVTGFVSLLLFRACMGLTEGPVLP
LSQTMMAQASSPHRRGLNMGLLQGSSAGLMGAVIAPPVMVALAENFGWRTAFYLTCIPGL
IVAWLIWRYVQEPAPARPDEAGATTDAAQDRAALPAGPQWGVLRERNVILCILISCFFLT
WFINIISFAPTFLVNVRQFSPGTMSALMSCLGLAWVIWGFAVPGISDRIGRRPTLFIFSL
VAACCPLAFLYAPTAVALGALLLLTYTGLGCFTLFMATIPAETVPRGAMATALGLIMGIG
ELIGGFLAPVAAGRAADLYGLPVVMWISMAGALIAGLLALGLRETAPAVLARQVSGNMTQ
GRQA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagactattcaaagaggcatcctacgaaaacaggttgttggcggtgctgttcctggcc
ttcggcttcgttttcttcgacaggctggccctgtcctatcttttcccctttgtgtcggcc
gaactgggcctgagcaataccgagctgggcatgttgtcgtcggtgctggcactggcctgg
gcggtgtcgggggcgttcatgggggcctatacggacaggcgcggtcggcgcaagaccatc
ctgatcgtatcggtcgtgctgttctctgttttttccgcgctgtccggcctggtgacgggc
tttgtcagcctgctgttgttccgcgcctgcatggggctgaccgaaggcccggtgctgccc
ctgtcgcagaccatgatggcgcaggcgtcctcgccccatcggcgcggcctgaatatgggc
ttgctgcaaggctcatccgccggcctgatgggcgcggtgatcgctccgccggtcatggtg
gcgctggcggaaaacttcggctggcgcacggcgttctacctgacctgcattcccggcctg
atcgtggcctggctcatctggcgctatgtgcaggagccggccccggcccggccagacgag
gcgggcgccacgacagatgcggcgcaagaccgagcggcgctgccggcagggccgcaatgg
ggagtgctgcgtgaacgcaatgtcattctctgcatcctgatcagctgctttttcctgacc
tggttcatcaacatcatttccttcgcgcccactttcctggtgaacgtgcggcagttcagc
cccggcaccatgagtgcattgatgagctgcctgggcctggcctgggtgatctgggggttc
gccgtgccgggtatctccgaccgtatcggccggcgtccgacgctgttcatcttctcgctg
gtggccgcctgctgcccgctggcattcctgtatgcgccgacggcagtggcgctgggcgcg
ctgctgttgctgacctataccggcctgggttgcttcacgctgttcatggccacgattccg
gcagagacagtgccgcgcggggccatggcgacggcgctgggcctgatcatgggcataggg
gaactgataggcgggttcctggccccggtggcggctggccgggcggccgacctgtacggc
ctgccggtggtgatgtggatttcgatggcaggcgcgctgatcgcggggttgctggcgctg
ggcctgcgtgaaacggcaccggcggtgctggcgcgccaggtttcgggaaacatgacccaa
gggaggcaggcatga

DBGET integrated database retrieval system