KEGG   Kerstersia gyiorum: EHF36_07260Help
Entry
EHF36_07260       CDS       T05924                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
kgy  Kerstersia gyiorum
Pathway
kgy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:kgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EHF36_07260
Enzymes [BR:kgy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     EHF36_07260
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     EHF36_07260
    1.1.1.-  
     EHF36_07260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 DZR 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: QBR40450
LinkDB All DBs
Position
1643583..1644635
Genome map
AA seq 350 aa AA seqDB search
MKAWFWHGARDLRLQETALRPLQRGEVRIEVAYCGICGSDLHEYADGPHSIPVVQPHPLS
GRQAPLIIGHEFCGTVLETAADVTTLRPGARVTIEPEYRCGHCTHCLAGDYNLCVSMGFA
GLMGDGGMAQQAVVPAYMAHELPNEVPFEQAAVAEPAAVALHAVRRSRLRPGDTCVIFGL
GAIGQLLVMMARLQGAGQIIAVDVVPARLALARQLGADLTLDARHDDVRTVALAHTDGAG
APVSFEAAGSQATFDGALQVLCKGGEMVLVGLVPQVRLDSFDLVNRELSITSSVGYRGVY
PDLLAWIAEGRLDLSQVVTRIVALEDAVTDGFEAQLQSRDEIKILVRPCG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcatggttctggcatggggcgcgtgacctgcgcctgcaggaaacggcgctgcgg
ccattgcagcgcggggaagtgcgcatcgaagtcgcctattgcggtatttgcggcagcgac
ctgcacgagtacgccgacggcccgcattccattccggtggtgcagcctcatcccttgtcc
ggtcgccaggcgccgctcattatcggccacgagttctgcggcacggtattggaaaccgcg
gccgacgtgaccacgctgcgccccggcgcacgggtgacgatagagccggagtaccgttgc
gggcattgcacgcattgcctggcgggcgactacaacctgtgcgtgtccatggggtttgca
ggattgatgggcgatggcggcatggcccagcaggcggtcgtgccagcctatatggcgcat
gagttgccgaacgaggtaccgttcgagcaggccgcagtggcggaacccgctgccgtggcg
ctgcatgccgtcaggcgcagccgtctgcggcctggggatacctgcgtgatcttcgggctg
ggtgccatcggccagttgctggtgatgatggcgcgcctgcagggggccgggcaaatcatt
gccgtcgatgtcgtgcccgctcgcctggcgttggcaaggcagttgggcgccgacctgacc
ctggatgcccgccatgacgatgtgcgcactgtggcgctggcgcacaccgatggcgccggg
gcaccggtcagtttcgaggcggcaggcagccaggcgaccttcgacggtgcgttgcaggtg
ctgtgcaagggcggggaaatggtgctggtggggctggtgccccaggtgaggctggacagt
tttgatctggtcaaccgggagttgagcattaccagcagcgttggctatcgcggggtctat
ccggacctgctggcctggattgcagaaggccgcctggatctttctcaggtcgtgactcgt
attgtggcattggaagatgccgtgacagatggctttgaagcgcagttgcaaagccgcgac
gagatcaagattctggtgcggccttgtggttga

DBGET integrated database retrieval system