KEGG   Kerstersia gyiorum: EHF36_15050Help
Entry
EHF36_15050       CDS       T05924                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
kgy  Kerstersia gyiorum
Pathway
kgy00970  Aminoacyl-tRNA biosynthesis
kgy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kgy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EHF36_15050 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:kgy03029]
    EHF36_15050 (gatB)
Enzymes [BR:kgy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EHF36_15050 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EHF36_15050 (gatB)
Mitochondrial biogenesis [BR:kgy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EHF36_15050 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey FAA_hydrolase_N YqeY
Motif
Other DBs
NCBI-ProteinID: QBR41792
LinkDB All DBs
Position
3457891..3459348
Genome map
AA seq 485 aa AA seqDB search
MAWEIVIGLETHTQLSTHSKIFSGSSTRFGAAPNTQANLVDMALPGSLPVPNYGAVERAI
RFGLAVGAHIAPLSVFARKNYFYADLPKGYQISQFEIPVVQGGSLSFFVGEERRTVNLTR
AHLEEDAGKSLHDDFTFANGTPATGIDLNRAGTPLLEIVSEPEMRSAAEAVGYARALHSL
VVWLGICDGNMQEGSFRVDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAILYEARRQIE
LIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPPIAISPEWIEAVRSAMP
ELPAALQARLQEQYGVTAYDASQLGADRDTAAYFEQAAAAVPEGHAKTLANWIMGELAAA
LNREEKTIADSPISAASLAKLVTRIADGTVSNKIAREIFAALWAGEGNGDADAIIESRGL
KQISDSGAIGAMIDEVLATNPAIVEEYRAGKQKAFNSLVGQIMKAAKGKANPQQVNSLLK
EKLDS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcctgggaaatcgtcatcggattggaaacccatacccagctttccacccattccaaa
attttctctggcagcagcacccgcttcggcgccgcgcccaatacccaggccaacctggtg
gatatggcgctgcccggcagcctgcccgtgcccaactatggcgccgtggagcgtgccatc
cgtttcggcctggccgttggcgcgcatatcgcgccgctttcggtgtttgcccggaagaat
tatttctacgcggacttgcccaagggctatcagatttcgcagtttgagatcccggtggtg
cagggcggcagtctgagctttttcgtgggcgaggagcgcaggacggtcaacctgacccgc
gcccacctggaagaagacgccggcaagtcgctgcatgatgatttcacgtttgccaatggc
acgcctgcaaccggcatcgacctgaaccgcgccggtacgccgctgctggaaatcgtttcc
gaaccagaaatgcgttcggcagccgaggccgtgggctacgcccgcgccctgcatagcctg
gtagtttggctgggcatctgcgacggcaacatgcaggaaggttcgttccgcgtggacgcc
aacgtgtcggtgcgtccggttggccagaaggagttcggcacccgtacggaaatcaagaac
gtgaactcgttccgtttcctggaacgcgccatcctctacgaggcgcgccgccagatcgag
ctgatcgaggacggcggcaccgtggtgcaggaaacccgcctgtacgatgccgaccgcgac
gaaacgcgcagcatgcgcagcaaggaagatgcgcacgattaccgctacttccccgatccc
gacctgcctccgatcgcgatttcaccggaatggatcgaggcagtgcgctcggccatgccc
gagctgcccgccgccctgcaggcccgcctgcaggagcagtatggcgtgacggcctatgat
gcatcccaactgggcgcagaccgcgacaccgccgcctatttcgagcaggccgctgcagcc
gtgccggaaggccatgccaagacgctagccaactggatcatgggcgaactggcagctgcg
ctgaaccgcgaggagaagacgattgcggacagcccgatcagcgccgcgagcctggccaag
ctggtaacccgcattgccgacggcacggtatccaacaagatcgcccgcgagatattcgcg
gcgctgtgggccggcgaaggcaatggcgatgccgatgcgatcatcgagtctcgcggcctg
aagcagatcagcgattctggcgcgatcggcgcgatgatcgacgaagtgctggcgaccaat
ccggcgattgtcgaggagtatcgcgccgggaagcagaaggcgttcaactcgctggtaggc
cagatcatgaaggccgccaagggcaaggcgaacccgcagcaggtcaatagcctgttgaag
gaaaagctcgatagctaa

DBGET integrated database retrieval system