KEGG   Kluyvera intermedia: NCTC12125_01587Help
Entry
NCTC12125_01587   CDS       T06042                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
kie  Kluyvera intermedia
Pathway
kie00061  Fatty acid biosynthesis
kie00780  Biotin metabolism
kie01100  Metabolic pathways
kie01130  Biosynthesis of antibiotics
kie01212  Fatty acid metabolism
Module
kie_M00083  Fatty acid biosynthesis, elongation
kie_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kie00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCTC12125_01587 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NCTC12125_01587 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NCTC12125_01587 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kie01004]
    NCTC12125_01587 (fabI)
Enzymes [BR:kie01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NCTC12125_01587 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NCTC12125_01587 (fabI)
Lipid biosynthesis proteins [BR:kie01004]
 Fatty acid synthase
  Component type
   NCTC12125_01587 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: VDZ83495
UniProt: A0A447MHP9
LinkDB All DBs
Position
1:1457995..1458798
Genome map
AA seq 267 aa AA seqDB search
MGFLSGKRILITGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAALDSSLV
LPCDVAEDASIESLFIDLAKVWPKFDGFVHSIGFAPADQLDGDYVNAVTREGFKIAHDIS
AYSFVAMAKSCRSMLNPDSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GIRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSNLSAGI
TGEIVHVDGGFSIAAMNELELKMHGAE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaaacgcattctgattactggcgtggccagcaaattgtctatc
gcctacggtatcgctcaggcgatgcaccgtgaaggcgctgaactggcgttcacctatcag
aacgacaagttgaaaggccgcgtggaagagtttgccgccgcgctggactccagccttgtc
ctaccatgcgatgtggctgaagatgctagcattgaatctctgtttatcgacttagccaaa
gtctggccgaaatttgacggtttcgtgcactcaattggttttgctccagccgatcagtta
gacggcgattatgtgaatgccgtgacgcgcgaaggctttaaaatcgcccacgacattagc
gcctatagttttgtcgccatggcaaaatcctgtcgcagtatgctaaacccagactctgcc
ctgttgaccctgtcttacctgggcgcagagcgcgccatccctaactacaacgtcatgggt
ctggcaaaagcctctttggaagcaaacgtgcgatatatggcgaatgcgatgggcccggaa
gggatccgcgtaaacgccatctctgcgggcccgatccgtacgctggccgcctccggtatc
aaagatttccgcaaaatgctcgcgcattgcgaagcggtgacgccaatccgtcgcacggtg
acgattgaagatgtgggcaattccgcggctttcttgtgctccaatctgtccgccggtatt
accggtgagattgtgcacgttgacggcggtttcagcattgcggcgatgaacgagctggaa
ttaaagatgcatggagcagagtga

DBGET integrated database retrieval system