KEGG   Kluyvera intermedia: NCTC12125_02175Help
Entry
NCTC12125_02175   CDS       T06042                                 

Gene name
glnH_1
Definition
(GenBank) Glutamine-binding periplasmic protein precursor
  KO
K10036  glutamine transport system substrate-binding protein
Organism
kie  Kluyvera intermedia
Pathway
kie02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kie00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NCTC12125_02175 (glnH_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kie02000]
    NCTC12125_02175 (glnH_1)
Transporters [BR:kie02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    NCTC12125_02175 (glnH_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: VDZ84073
UniProt: A0A447MJB7
LinkDB All DBs
Position
1:1981503..1982249
Genome map
AA seq 248 aa AA seqDB search
MKSMFKVSLAALTLAFAVSSQAAEKQLVVATDTAFVPFEFKQGNQYVGFDVDLWAAIAKE
LKLDYTLKPMDFSGIIPALQTKNIDLALAGITITEERKKAIDFSDGYYKSGLLVMVKANN
NDIKSVKDLDGKVVAVKGGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDT
PNILYFIKTAGNGQFKAVGESLEAQQYGIAFSKGNDELREKVNGALKTLRENGTYNEIYK
KWFGTEPK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaatgtttaaagtttcactggctgcactcaccctggcttttgccgtttcttct
caagccgcagagaaacaactggttgtcgcaacggataccgcattcgttccgtttgaattc
aaacagggtaatcaatatgtcggctttgatgttgatctgtgggcggcaattgcgaaagaa
ctgaaactggattacaccctgaagccaatggacttcagcggcattatcccagcgttgcag
actaaaaatatcgatctggcgctggctggtattaccatcaccgaagaacgtaaaaaagcg
atcgatttctctgatggctactacaaaagcggcctactggtgatggtgaaagccaacaac
aacgacatcaagagcgttaaagatctcgatggcaaagtggttgcggttaaaggcggcacc
ggttccgttgattacgcgaaagccaatatcaaaaccaaagacctgcgtcagttcccgaac
atcgacaacgcctatatggaactcggcactaaccgcgctgacgcggttctgcacgatacg
ccaaacattctgtacttcatcaaaaccgccggtaatggtcagttcaaagccgttggtgag
tctctggaagcacagcagtacggtattgcgttctctaaaggcaacgacgaactgcgtgaa
aaagttaacggcgcgctgaaaacgctgcgtgagaacggcacctacaacgaaatttacaaa
aaatggttcggtactgagccaaaataa

DBGET integrated database retrieval system