KEGG   Kluyvera intermedia: NCTC12125_02360Help
Entry
NCTC12125_02360   CDS       T06042                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kie  Kluyvera intermedia
Brite
KEGG Orthology (KO) [BR:kie00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC12125_02360 (ahpF)
Enzymes [BR:kie01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC12125_02360 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Thi4 FAD_binding_3 K_oxygenase NAD_binding_8 FMO-like Glutaredoxin AlaDh_PNT_C DAO NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: VDZ84240
UniProt: A0A3S4GK12
LinkDB All DBs
Position
1:complement(2146713..2148278)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDGAKSAEIKELLAEIAELSDKVTFKEDNTLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGVYQNEITERNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNEYNVDVIDSQSASKLIPAAVEG
GLHQIETASGAVLKARSIIISTGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLQYRDRVSGDEHHVALAGIFVQIGLLPNTNWLEGAIERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcttaccttgagaagctgaccaaacct
gttgagctgattgccacgctggatgacggcgcaaaatcggcagagatcaaggaactgttg
gctgaaatcgctgaactgtcagataaagtgacctttaaagaagacaacaccctggcagtg
cgtaagccatcgttcctgattactaatccaggttctgatcaggggccgcgttttgcaggc
tccccgctgggccacgagtttacctcgctggtactggcgctgttgtggactggtggtcat
ccgtcaaaagaggcacagtctctgcttgagcagattcgcgaccttgacggtgattttgaa
tttgaaacgtactattcgctttcatgccacaactgcccggatgttgtgcaggcgctgaac
ctgatggcggtgctgaatccacgcattaaacataccgcgattgacggtggggtttaccag
aacgaaatcacggaacgtaacgtgatgggcgttccggcggtctacctgaacggtcaggaa
tttggtcaggggcgtatgacgctgactgagatcgtagcgaaagtcgataccggtgcggaa
aaacgcgcagcggaagaactgaatcaacgcgatgcctatgacgtgctgatcgtcggatcc
ggcccgtccggcgcagcggctgcggtgtattctgcacgtaaaggtattcgtacaggcttg
atgggcgaacgctttggcggccaggtgctggatacggtcgacattgagaactacatctcc
gtgccgaagacggaaggccagaagctggcgggtgcgttaaaagcacacgtgaatgaatat
aacgttgatgtgattgattctcagagtgcttcaaagctgattccggcagcggtagaaggt
ggtctgcatcagattgaaacggcttccggcgcggtgctgaaagcacgcagtatcatcatt
tctaccggtgctaaatggcgtaacatgaacgtaccgggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgtgatggcccgctgtttaaaggcaaacgcgtggcggtg
atcggcggcggtaactccggtgttgaagcggcgattgacctggcgggcgtggttgaacac
gtgacgttgctggaatttgccccagaaatgaaagccgatcaggtattgcaggataaagtg
cgcagcttgaaaaacgtcgacattatcctgaacgcgcaaaccacggaagtgaaaggtgat
ggcagcaaagtcaccggcttacagtaccgtgaccgcgtgagtggcgatgagcatcatgtt
gcgcttgcgggtatctttgttcagattggcctgctgccgaacactaactggctggaaggc
gctatcgaacgtaatcgtatgggtgaaattatcatcgatgcgaaatgtgaaacgaacgtc
aaaggcgtatttgcggcgggcgactgtaccaccgtgccttacaaacaaattatcatcgcc
gcaggcgagggtgcgaaggcgtcattgagcgcatttgattatctgattcgcaccaaaaca
gcataa

DBGET integrated database retrieval system