KEGG   Kluyvera intermedia: NCTC12125_04489
Entry
NCTC12125_04489   CDS       T06042                                 

Gene name
gutB_2
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kie  Kluyvera intermedia
Pathway
kie00052  Galactose metabolism
kie01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kie00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NCTC12125_04489 (gutB_2)
Enzymes [BR:kie01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     NCTC12125_04489 (gutB_2)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N MTS Methyltransf_24 PrmA Pyr_redox_2 Methyltransf_31 3HCDH_N Methyltransf_11 CoA_binding Shikimate_DH FAD_binding_2 Pyr_redox ELFV_dehydrog Met_10 PALP Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: VDZ86259
UniProt: A0A447MQP8
LinkDB
Position
1:complement(4168307..4169350)
AA seq 347 aa
MKSVVIHAEGDVRVEERPMPTLKNDDDVLVKVICSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGSAVTDMQPGDAVACVPLLPCFDCPQCARGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANIFRLPSEMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGAKSVTAIDINPQKLELAKSLGATYVFNSREMNSKAIQAALEEVQFDQLVLETAGTP
QTVALAIEAAGPRAQVALVGTLHHDLTLLSATFGLILRKELTLIGSWMNYSAPWPGEEWD
TAARLLTEKRIQLAPLIAHQGDAESFAREVQALNGAPMQGKILLKLA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgattcacgctgagggagacgtgcgcgttgaagaacgcccaatgcca
accttaaagaacgacgatgatgtgctggtcaaagtcatctgttcgggactttgcggttca
gatattccgcgcattttcgcgaaaggcgcgcactattatccgattacgctggggcatgag
ttcagcggctatgtcgaatcctatggcagcgccgtcaccgatatgcagccgggtgatgcc
gttgcctgcgtaccgctcctgccgtgctttgactgtccgcagtgcgcacgcggttacttc
tcattatgcaaacagtaccagttcgtcggctcgcgtagcgaaggcggcaatgccgaatat
gtggtggtcaaacgcgcaaatatcttccgtctaccgagtgaaatgccgatagatgatggt
gcgtttattgaaccgattaccgttgggctgcatgccttccatctggcacaaggctgcgaa
gggaaaaatgtcattatcatcggtgccgggaccatcggcctgctggcactgcaatgcgcc
cgcgagctgggggccaaaagcgtgactgctattgatatcaacccgcaaaagctagaattg
gcaaaatcacttggcgcaacatacgttttcaatagccgcgagatgaacagcaaagcaatc
caggcagcactggaagaggttcagttcgatcaattggttctggaaaccgcagggacaccg
caaaccgtggcccttgccattgaggccgccggccctcgcgcacaagtggcgttagtgggt
acgttacatcacgatctcaccttactctccgcaaccttcggtctgattctgcgtaaagag
ttgacgcttatcggcagttggatgaactactccgcgccgtggccgggcgaagagtgggac
accgccgctcgactgttaacagaaaaacgtattcagcttgctccgctcatcgcacaccag
ggcgatgctgaaagttttgctcgcgaagttcaggcgcttaacggcgcaccaatgcaggga
aaaatcctgctcaaactggcgtaa

DBGET integrated database retrieval system