KEGG   Kocuria indica: KocCE7_08660
Entry
KocCE7_08660      CDS       T05866                                 

Definition
(GenBank) S-ribosylhomocysteine lyase
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
kii  Kocuria indica
Pathway
kii00270  Cysteine and methionine metabolism
kii01100  Metabolic pathways
kii01230  Biosynthesis of amino acids
kii02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:kii00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KocCE7_08660
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    KocCE7_08660
Enzymes [BR:kii01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     KocCE7_08660
SSDB
Motif
Pfam: LuxS
Other DBs
NCBI-ProteinID: QBJ21865
UniProt: A0A4V0ZR42
LinkDB
Position
1928178..1928636
AA seq 152 aa
MQKMNVESFNLDHRSVAAPYVRIADRKELPGGDTLVKYDVRFTQPNQAHLEMPAVHSIEH
LTAEHMRNHTDALIDFSPMGCQTGFYALMLGVETEEFERLLERTFRDILEADEVPAANEV
QCGWGANHSLEAAQDAVRGFLAEREHWDEVTR
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcagaagatgaacgtcgaatcattcaacctggaccaccgcagcgtggccgccccctac
gtgcggatcgcggatcggaaggaactgccgggtggtgacaccctcgtgaagtacgacgtc
cgcttcacccagcccaaccaggcgcacctggagatgccggcggtacactcgatcgagcac
ctcaccgcggagcacatgcgcaatcacacggacgccctgatcgacttctcccccatgggc
tgccagaccggtttctacgcgctcatgctgggagtggagaccgaggagttcgagcgcctg
ctcgagcgcaccttccgggacatcctcgaggcggacgaagtcccggccgcgaacgaggtg
cagtgcggctggggcgccaaccacagtctcgaggccgcccaggacgcggtgcgcggattc
ctggccgagcgcgagcactgggacgaggtcacgcggtga

DBGET integrated database retrieval system