KEGG   Kocuria indica: KocCE7_08700Help
Entry
KocCE7_08700      CDS       T05866                                 

Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
kii  Kocuria indica
Brite
KEGG Orthology (KO) [BR:kii00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kii03012]
    KocCE7_08700
   03029 Mitochondrial biogenesis [BR:kii03029]
    KocCE7_08700
Translation factors [BR:kii03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    KocCE7_08700
 Prokaryotic Type
   KocCE7_08700
Mitochondrial biogenesis [BR:kii03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    KocCE7_08700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU IF-2 IF2_N MMR_HSR1 GTP_EFTU_D2 Ras SRPRB Roc RsgA_GTPase FeoB_N
Motif
Other DBs
NCBI-ProteinID: QBJ21871
LinkDB All DBs
Position
complement(1934118..1937036)
Genome map
AA seq 972 aa AA seqDB search
MAKPRVHELAKELGITSKEAISKLQELGEFVRGASSTVEPPVAKKLRSAYPAGGDSAAQS
KNAAGGNSGKPAQQGARKPAEKSSAPKPGGRVQSKPAGSDAAAKPAAGSAALTPGAPKAP
AKPVSEHQASETPVAKPAAFKPAASDSATPRSAATPGPRANAPKPGSVKPGQSAPRPGNN
PFASQQGMGRGSDGGQRAPRPGQQRSAKPGAPRPGNNPFASQQGMRSSNAGQGGPRPGGP
RPGGPRPAQAGQGGPRPGAPRTGAPRTGQGGPRPGGPRPSPNMMPGHTTGVAPIGSRPAP
GGGPRRGGGAGGGGTGGGGGFRGRGGRGGTQGAFGRGGARGKHRKSKRAKRQELEQMSAP
AVGGVSVPHGDGSTVVRLRRGASLMDFAEKINANPASLVTVLIHLGEMATQTQSLDEDTF
QLLGAELGYQIQVVSPEDEERELLESFDIDLEAELEAEGEDVLAPRPPVVTVMGHVDHGK
TRLLDAIRNTKVIEGEAGGITQHIGAYQISTEVDGQERPITFIDTPGHEAFTAMRARGAQ
VTDIAVLVVAADDGVMPQTVEALNHAQAANVPIVVAVNKVDKPDANPEKIRGQLTEYGLV
PEEYGGDTMFVDVSARENLHIDDLLDAIVLTADGALELQANPDKNARGVAIEANLDKGRG
AVCTVLVQSGTLTVGDSIVAGAAYGRVRAMFDEMGRTVEAALPSRPVQVLGLSSVPRAGD
TFLATQEERTARQIAEKREAADRNAQLAKRRKRITLESFDEAVAEGKIDTLNLIIKGDVS
GAVEALEDSLLKIDVGEEVQLRVIHRGVGAITQNDVNLATVDNAVIIGFNVRPAERVTDL
AEREGVEMKFYSVIYNAIDDVESALKGMLKPEYEEVELGTAEIREVFRSSKWGNIAGAYI
TKGVVRRNGKARLVRDGNVVQDNLTIDSLRRFKDDATEVREGYECGIGLGSFNDIREGDL
IETWEMREKPRD
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagccccgtgtccacgagctcgccaaagagctcggaatcacgtccaaggaagct
atttccaaacttcaggaactcggcgaattcgttcgcggagcgtcctccacggtggaaccg
cccgtggccaagaaactgcgttcggcgtaccccgccggcggcgattccgccgcccagtcc
aagaatgccgccgggggcaactccggcaagcccgcgcagcagggcgccaggaagcccgcg
gagaagtcctccgcgcccaagcccgggggcagggtccagtccaagcccgccggttccgac
gccgcggccaagcccgctgccggatccgccgcgctgaccccgggtgcccccaaggccccc
gcgaagccggtgtccgagcaccaagcctccgagaccccggtcgcgaagcccgctgccttc
aagcccgccgcctccgactcggccacgccgcgcagtgcggcgaccccgggcccccgtgcc
aacgcccccaagcccggtagtgtcaagccgggtcagtccgcaccgcgtccggggaacaac
ccgttcgcgtcccaacagggcatgggccgcggttccgacggtggtcagcgtgcgccgcgc
cccggccagcagcgctcggccaagcccggagcaccgcgtccggggaacaacccgttcgcg
tcccagcaggggatgcgttcgagcaatgccggtcagggcggaccccgtcccggcggtccc
cgtccgggtggccctcgtcccgctcaggcgggccagggtggcccgcgtcccggtgcgccc
cgtacgggtgcaccgcgaacgggtcagggcggcccccgtcccggtgggccccgcccctcg
ccgaacatgatgcccggtcacaccacgggtgtggccccgatcggtagccgcccggcaccc
ggtgggggaccccgccgcggtggtggcgccggcggtggtggtaccggtggcggcggtggt
ttccgcggccgcggtggccgcggtggcacgcaaggtgccttcggtcgcggtggtgcccgc
ggcaagcaccgcaagtcgaagcgggcgaagcgccaggagctcgagcagatgagcgcaccc
gccgtcggcggcgtgtcggttccccacggcgacggcagcactgtggtgcggctgcgccgc
ggtgcctcgctcatggacttcgcggagaagatcaacgcgaacccggcgtcgctcgtgacc
gtgctcatccacctgggtgagatggccacgcagacccagtccctggacgaggacaccttc
cagctgctgggtgccgagctcggctaccagatccaggtggtctccccggaggacgaggag
cgcgagctgctcgagtccttcgacatcgacctcgaggcggaactggaggctgagggcgag
gacgtcctggcaccgcgcccgccggtggtcactgtcatgggtcacgtggaccacggtaag
acccgcctgctggacgcgatccgtaacaccaaggtgatcgagggtgaggccggcggcatc
acccagcacatcggtgcgtaccagatctccaccgaggtggacggtcaggaacggcccatc
acgttcatcgacaccccgggtcacgaggcgttcaccgcgatgcgtgcccgtggtgcgcag
gtcacggacatcgccgtgctcgtggtcgccgcggacgacggcgtgatgccgcagaccgtc
gaggcactcaaccacgcccaggcggcgaacgtgccgatcgtggtggccgtgaacaaggtc
gacaagccggacgccaacccggagaagatccgcggtcagctcaccgagtacggcctggtg
cccgaggagtacggcggcgacaccatgttcgtggacgtctccgcccgcgagaacctgcac
atcgacgacttgctggacgccatcgtgctcacggcggacggcgctctggaactgcaggcg
aacccggacaagaacgcccgcggcgtcgccatcgaagccaacctggacaagggccgcggc
gcggtgtgcaccgtgctggtccagtccggcaccctcaccgtgggcgattcgatcgtggcc
ggtgccgcgtacggtcgcgtgcgtgccatgttcgacgagatgggccgcaccgtggaggcg
gcgctgccgtcccgccctgtgcaggtgctgggtctgtcctccgtgccgcgcgcgggtgac
acgttcctggccacccaggaggagcgcaccgcgcgtcagatcgctgagaagcgtgaggcc
gcggaccgcaatgcccaactcgccaagcgccgcaagcggatcacgctcgagtccttcgac
gaggccgtggccgagggcaagatcgataccctcaacctcatcatcaagggtgacgtgtcc
ggtgccgtggaggcgctcgaggactcgctgctcaagatcgacgtgggcgaagaggtccag
ctacgggtcatccaccgcggcgtgggcgcgatcacccagaacgacgtcaacctggccacg
gtggacaacgccgtgatcatcggcttcaacgtccgtcccgccgagcgcgtgacggacctg
gccgagcgcgagggcgtggagatgaagttctactccgtgatctacaacgcgatcgacgac
gtcgagagcgcgctcaagggcatgctcaagccggagtacgaggaggtggagctcggtacc
gccgagatccgcgaggtcttccgctcgtccaagtggggcaacatcgccggtgcgtacatc
accaagggtgtggtgcgccgcaacggcaaggcccgcctggtgcgcgacggcaacgtggtg
caggacaacctcaccatcgattcgctgcgccggttcaaggacgacgccaccgaggtgcgc
gagggttacgagtgcggtatcggactcggttccttcaacgacatccgcgagggtgacctc
atcgagacctgggagatgcgcgagaagccgcgcgactga

DBGET integrated database retrieval system