KEGG   Kocuria indica: KocCE7_11220Help
Entry
KocCE7_11220      CDS       T05866                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
kii  Kocuria indica
Brite
KEGG Orthology (KO) [BR:kii00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kii01001]
    KocCE7_11220
Enzymes [BR:kii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KocCE7_11220
Protein kinases [BR:kii01001]
 Serine/threonine kinases: Other
  Bacterial family
   KocCE7_11220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: QBJ22278
UniProt: A0A4P6RRR6
LinkDB All DBs
Position
2508630..2510441
Genome map
AA seq 603 aa AA seqDB search
MRPSSNTTLGGRYALTERIAIGGMGEVWKAKDQVLGRIVAVKILKDEYNGDPTFLQRFRA
EARHTALLNHPGVANVFDYGEDEGSAFLVMELVPGEPLSNIIDRQKSLDPDTVLNYIGQT
ARALAAAHAQGLVHRDVKPGNLIITPDNRVKVTDFGIARLADQVPLTATGQVMGTAQYLA
PEQATGQTATGSSDIYSLGIIGYELLAGRRPFTGESQIAIALAQVNDNPPALPDSIPDPV
RALIMSMLAKDPEERPENAGKLANAVDALRRGDVTAAVTMVPGMQPFLSQDFSDEQPTEA
IAPVSGPSTRPMSWTAAAGVTGSAAAAAQPDPKYSAHPSTAQFDAVNRPPNSQRGSTPQG
ERRKTSVWAWLLPLLALLVALAMAGVYFFSSRDDSGSPAPGIVTSSTVSPTANTVVLPAN
MVGRDADQVASEITAMGVNVDKRLQQGTGQAENTVVSVEPAAGSRVKVGSTVVMYVAWTP
GAQTTSGAGTGGTSATQSPQQQPEQNQNTQAPQQTAQPAPTNGGGNGAGNGGGADNGGAG
NGATNGAGETGQNGANTQADTGAQGTTDQSARTEAGSGQSNPVQGTGDGALAAPSAPGSG
AGG
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgagaccatcgtcgaacaccaccctgggcggtcgttacgccctgacggaacgaattgcc
atcggcggcatgggcgaggtgtggaaggccaaggatcaggtcctgggtcggatcgtcgcg
gtgaagatcctcaaggacgagtacaacggggatcccacgttcctgcagcggttccgggcg
gaggcccgccacaccgccctgctcaaccacccgggtgtggccaacgtcttcgactacggc
gaggacgagggctccgcgttcctggtcatggaactcgtgcccggcgaaccgctgtccaac
atcatcgaccggcagaagtcgttggacccggacacggtcctgaactacatcggccagacc
gcccgcgccctggccgccgcgcacgcgcaagggctcgtgcaccgggacgtgaagcccggc
aacctgatcatcaccccggacaaccgcgtcaaggtcaccgacttcggcatcgcccggctc
gcggaccaggtgccgctcacggccaccggccaggtcatgggcacggcccagtacctggct
cccgagcaggccaccggtcagaccgccacgggctcctcggacatctactccctggggatc
atcggctacgaactgctcgccggccggcgccccttcacgggggaatcccagatcgcgatc
gccctggcccaggtcaacgacaaccctcccgcgctgccggactccatcccggacccggtg
cgcgccctcatcatgtccatgcttgccaaggacccggaggaacgcccggagaacgcgggc
aagctcgccaacgccgtggatgcgctgcgccgcggggacgtcacggccgcggtcacgatg
gtcccggggatgcagccgttcctgtcccaggacttctccgacgagcaacccaccgaggcc
atcgcaccggtctcgggaccgagcacccggcccatgtcctggacggccgccgcgggagtg
accggttcggccgcagccgcggcccagccggaccccaagtacagcgcccacccctctacc
gcacagttcgacgccgtgaaccggccaccgaactcgcagcgcggttccaccccgcagggt
gagcggcgcaagacgtccgtgtgggcgtggttgttgccgctgctcgcacttctggtggcc
ctggccatggccggggtgtacttcttctcctcgcgggacgattccggctcccccgcaccg
ggcatcgtcacgtcctccaccgtgagccccaccgcgaacaccgtggtgttgcccgccaac
atggtgggccgcgacgcggaccaggtcgcctccgagatcaccgccatgggcgtgaacgtg
gacaagcggctgcagcagggcacgggtcaggcggagaacaccgtggtctccgtggaaccc
gcggccggttcgcgggtgaaggtcggttccaccgtggtgatgtacgtcgcgtggaccccg
ggtgcccagacgacctcgggcgccgggaccgggggcaccagtgccacgcagtcaccgcag
caacagcccgagcagaaccagaacacccaggcaccgcagcagaccgctcagcccgctccc
accaacggcgggggcaatggcgccggtaacggcggcggcgcggacaacggcggggccggt
aacggagccaccaacggcgccggggagaccggccagaacggagcgaacacccaggcggac
accggcgcccaggggaccacggatcagagcgcccgcaccgaggcaggatcggggcagtcc
aaccccgtgcagggcaccggtgacggggcgctcgcggctccgagcgctcccggcagcggc
gcgggcggctga

DBGET integrated database retrieval system