KEGG   Kluyvera intermedia: AB182_17480Help
Entry
AB182_17480       CDS       T03950                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kin  Kluyvera intermedia
Pathway
kin00010  Glycolysis / Gluconeogenesis
kin00260  Glycine, serine and threonine metabolism
kin00680  Methane metabolism
kin01100  Metabolic pathways
kin01110  Biosynthesis of secondary metabolites
kin01120  Microbial metabolism in diverse environments
kin01130  Biosynthesis of antibiotics
kin01200  Carbon metabolism
kin01230  Biosynthesis of amino acids
Module
kin_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kin_M00002  Glycolysis, core module involving three-carbon compounds
kin_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB182_17480 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    AB182_17480 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB182_17480 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kin04131]
    AB182_17480 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kin04147]
    AB182_17480 (gpmA)
Enzymes [BR:kin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AB182_17480 (gpmA)
Membrane trafficking [BR:kin04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AB182_17480 (gpmA)
Exosome [BR:kin04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AB182_17480 (gpmA)
  Exosomal proteins of melanoma cells
   AB182_17480 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AKL12990
UniProt: A0A0G3QCK0
LinkDB All DBs
Position
2966078..2966830
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERFPGHDPRYAKLTEKELPTTESLALTIERVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPVKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaaactggttctggttcgtcacggcgaaagccagtggaacaatgaaaac
cgcttcaccggttggtatgacgttgatctgtccgagaaaggcgttagcgaagcaaaagcc
gcaggtaagctgctgaaggatgaaggcttcaccttcgactttgcatacacctcggtgctg
aaacgtgccatccacaccctgtggaatgtgctggacgaactggatcaggcctggctgccg
gttgagaaatcctggaaactgaacgagcgtcattacggtgcgctgcagggtctgaacaaa
gcggaaaccgctgaaaaatacggtgacgagcaggttaaacagtggcgtcgcggctttgct
gttactccgccggaactgacgaaagatgacgagcgtttcccgggccacgatccgcgttat
gcgaaactgaccgagaaagagctgccgaccaccgaaagcctggcgctgactatcgaacgc
gtagtgccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtaatc
atcgcggctcacggcaactccctgcgcgcgctggtgaaatacctggataatatgggcgaa
gacgaaattcttgaactgaatatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaaacctgtcaaacactactacctgggtaatgccgatgagatcgcggcgaaagcg
gctgccgttgccaaccagggtaaagcgaagtag

DBGET integrated database retrieval system