KEGG   Phytobacter ursingii: AB182_18000Help
Entry
AB182_18000       CDS       T03950                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kin  Phytobacter ursingii
Brite
KEGG Orthology (KO) [BR:kin00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AB182_18000
Enzymes [BR:kin01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AB182_18000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like Thi4 K_oxygenase FAD_binding_3 NAD_binding_8 DAO Glutaredoxin FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AKL13077
UniProt: A0A0G3QGF1
LinkDB All DBs
Position
complement(3065743..3067308)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSARSAEIKELLAEIAELSDKVSFKEDNTLAV
RKPSFLITNPGSSQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLTCHNCPDVVQALNLMAVLNPRIKHTAIDGGTYQNEITDRNVMGVPAVFVNGKE
FGQGRMTLAEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSEYDVDVIDSQSATKLTPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLGNVDIILNAQTTEVKGD
GSKLTGIEYRDRVSGDVHHIALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKRA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaacatgaaaacgcagctcaaggcttaccttgagaaactgactaaacct
gttgagctgattgccacgctggatgacagcgccagatcggcagaaatcaaggaactgttg
gctgaaattgctgaactgtcagataaagtctctttcaaagaagataacacgctggcagtg
cgcaagccgtccttcctgattaccaacccaggttcaagccaggggccacgttttgcgggt
tcgccgctgggccatgaattcacctctctggtgcttgcgctgctgtggaccggtgggcac
ccgtctaaagaagcgcaatctttgctcgagcagattcgtgatattgacggtgattttgag
tttgaaacgtattactcgctgacctgccataactgcccggatgtcgtacaggcgcttaac
ctgatggcggtgctgaacccgcgtatcaaacatacggctattgatggcggcacgtaccag
aatgaaatcactgaccgtaatgtgatgggcgttccggcagtcttcgtcaatggtaaagag
ttcggtcaggggcgtatgacgctggctgaaatcgtggcaaaaattgatactggcgcggaa
aaacgtgcagcggaagagctgaacaagcgtgatgcgtatgatgtgctgattgtcggttcc
ggcccgtctggtgcggcagcagcggtttactccgcacgtaaaggtatccgtaccgggttg
atgggtgagcgttttggtggccaggtgctggacactgtagacatcgaaaactatatctct
gtgccgaagaccgaaggccaaaaactggcgggcgcgctgaaagcgcatgtttctgaatac
gacgttgatgtgattgattcgcaaagtgcgaccaaactgacgccggctgcggtggaaggg
ggtctgcatcagattgaaactgcatcgggtgcggtgttgaaggcacgcagcatcattatt
gcgaccggggcaaagtggcgcaacatgaacgtgccgggcgaagaacagtatcgcaccaaa
ggggtgacctactgcccgcactgtgatggcccgctgtttaaaggtaagcgtgtggcggtc
atcggcggcggtaactccggcgtggaagctgccatcgacctggcaggtattgttgaacat
gtcaccctgctggagtttgcgcccgagatgaaagcagaccaggtgctgcaggataaagtg
cgtagcctcggtaatgttgacatcattttgaatgcgcaaaccaccgaagttaaaggcgat
ggcagcaaactgacgggtattgagtatcgcgatcgcgtgagcggtgatgtgcatcatatc
gcgctggccggtatcttcgtgcagattggtttactgccgaataccacctggctggaaggt
gctattgagcgcaaccgtatgggcgagatcatcattgacgcgaaatgtgaaaccagcgtc
aaaggcgtgttcgccgcgggtgactgcacgacggtgccgtacaagcaaattattatcgcc
acgggtgaaggagcgaaagcctctctgagtgcattcgactacctgatccgtacaaagcgt
gcataa

DBGET integrated database retrieval system